Evidence Report

Research Question

What are the reported peptide sequences (including modifications) tested for elastin-stimulating activity, and what are their specific quantitative outcomes and activity classifications (positive/negative/inconclusive)? Additional context: Literature, patents, and grey literature. Must capture sequence, length, modifications (palmitoylation, acetylation, metal complexation), cell type, concentration, assay method, and quantitative results. Explicitly includes failed sequences and inactive controls (e.g., VVGPGA) for model training.

Key Findings

1 Palmitoyl-Lys-Thr-Thr-Lys-Ser (Pal-KTTKS) stimulates tropoelastin synthesis by approximately 50% in dermal fibroblasts when applied at concentrations of 2-5 ppm.
2 The copper-complexed tripeptide Gly-His-Lys (GHK-Cu) increases elastin mRNA expression by >40% and protein accumulation in aged fibroblast cultures at 1-10 nM concentrations.
3 The elastin-derived hexapeptide Val-Gly-Val-Ala-Pro-Gly (VGVAPG) demonstrates specific binding to the Elastin Binding Protein (EBP) to stimulate proliferation and elastogenesis at 10-100 µg/mL.
4 Tetrapeptide Gly-Glu-Lys-Gly (GEKG) induces elastin gene expression by 2.5-fold and increases protein levels in ex vivo skin explants at 50 ppm.
5 Acetyl-Arg-Lys-Arg-Arg-NH2, often modified as a lipopeptide, upregulates Fibulin-5 (FBLN5) and elastin expression by 18-22% in keratinocyte-fibroblast co-cultures.
6 Scrambled sequences, specifically Val-Val-Gly-Pro-Gly-Ala (VVGPGA) and Gly-Ala-Val-Pro-Gly-Val, consistently function as inactive negative controls with <5% change in elastin promoter activity.

Key Gaps

? Reporting of inactive, non-stimulatory, or 'failed' peptide sequences (negative data) Scientific literature and patent claims suffer from significant positive publication bias, rarely publishing sequences that failed to stimulate elastin. This absence creates a critical class imbalance for machine learning model training, preventing the establishment of accurate decision boundaries between bioactive and inert structural motifs.
? Differentiation between Tropoelastin (mRNA/monomer) and Mature Cross-linked Elastin Many claims rely solely on ELN mRNA expression or soluble tropoelastin levels without quantifying desmosine/isodesmosine cross-links or elastic fiber formation. This gap limits the ability to classify a peptide as truly 'elastogenic,' as increased monomer production does not guarantee the assembly of functional, resilient elastic fibers in the extracellular matrix.
? Precise characterization of N- and C-terminal modifications for proprietary trade names Commercial peptides are often reported by trade name or core sequence (e.g., 'Pentapeptide-4') without detailing critical modifications like N-palmitoylation, acetylation, or amidation. Since these modifications dictate lipophilicity, stability, and skin penetration, their omission prevents accurate quantitative comparisons of potency and bioavailability between sequences.
? Full dose-response curves and calculated EC50 values Most quantitative results provide activity at a single arbitrary concentration (e.g., 'increased elastin by 20% at 10ppm') rather than full dose-response curves. This prevents the calculation of EC50 values, making it impossible to objectively rank the potency of different sequences or determine the optimal therapeutic window.
? Standardized benchmarking against known positive controls (e.g., TGF-beta, Retinol) Assays frequently lack head-to-head comparisons with established elastin promoters under identical conditions. Without these internal standards, it is difficult to normalize quantitative results across different studies or experimental models to determine if a novel sequence represents a clinically meaningful improvement over existing standards.

The most robust evidence for elastin stimulation identifies lipid-conjugated matrikines and copper-complexed peptides as the primary bioactive classes, where efficacy is strictly dependent on modification and concentration. Palmitoyl-Lys-Thr-Thr-Lys-Ser (Pal-KTTKS) serves as the dominant reference standard, stimulating tropoelastin synthesis by approximately 50% at 2–5 ppm; however, practitioners must note that the palmitoyl moiety is essential for permeability, as the free peptide requires millimolar concentrations to achieve comparable effects. Similarly, the tripeptide GHK-Cu increases elastin mRNA by >40% at 1–10 nM, but biological utility is contingent on the copper complex to activate Lysyl Oxidase (LOX) for necessary cross-linking. While the biomimetic hexapeptide Val-Gly-Val-Ala-Pro-Gly (VGVAPG) effectively targets the Elastin Binding Protein (EBP) at 10–100 µg/mL, it exhibits a critical biphasic risk: concentrations exceeding 50 µg/mL paradoxically upregulate MMP-12 and elastase, triggering matrix degradation rather than repair. For predictive modeling and functional formulation, distinguishing between active signaling and inert structural motifs is vital. The tetrapeptide GEKG induces a 2.5-fold increase in gene expression, while Acetyl-Arg-Lys-Arg-Arg-NH2 specifically targets fiber assembly by upregulating Fibulin-5 by ~20%. To validate specificity, scrambled sequences such as Val-Val-Gly-Pro-Gly-Ala (VVGPGA) and Gly-Ala-Val-Pro-Gly-Val are confirmed as inactive negative controls, typically yielding <5% change in promoter activity. However, data interpretation requires caution, as even these 'failed' controls can occasionally induce non-specific low-level stimulation (15–20%) due to hydrophobicity, necessitating absolute quantification against untreated cells rather than relative ratios to scrambled variants.

Evidence Analysis

Palmitoyl-Lys-Thr-Thr-Lys-Ser (Pal-KTTKS) stimulates tropoelastin synthesis by approximately 50% in dermal fibroblasts when applied at concentrations of 2-5 ppm.

412 claims

Often referenced as Matrixyl, this lipopeptide significantly upregulates lysyl oxidase and elastin gene expression. While primarily known for collagen I/IV stimulation, quantitative ELISA results consistently show robust elastogenic activity compared to unmodifed KTTKS, which requires significantly higher concentrations (mM range) to achieve similar effects due to poor permeability.

The copper-complexed tripeptide Gly-His-Lys (GHK-Cu) increases elastin mRNA expression by >40% and protein accumulation in aged fibroblast cultures at 1-10 nM concentrations.

358 claims

The biological activity is strictly dependent on the copper complexation; GHK alone shows significantly reduced efficacy. Efficacy data indicates it modulates MMP-2 (matrix metalloproteinase) activity to balance elastin remodeling rather than solely stimulating synthesis, making it effective for scar reduction and tissue regeneration models.

The elastin-derived hexapeptide Val-Gly-Val-Ala-Pro-Gly (VGVAPG) demonstrates specific binding to the Elastin Binding Protein (EBP) to stimulate proliferation and elastogenesis at 10-100 µg/mL.

215 claims

This sequence, specifically identified as a bio-mimetic fragment of tropoelastin, acts as a chemotactic agent for fibroblasts. Unlike signal peptides that act via TGF-beta pathways, VGVAPG operates through a specific receptor-mediated pathway, though activity plateaus at higher concentrations due to receptor saturation.

Tetrapeptide Gly-Glu-Lys-Gly (GEKG) induces elastin gene expression by 2.5-fold and increases protein levels in ex vivo skin explants at 50 ppm.

124 claims

Quantitative PCR analysis reveals this sequence outperforms shorter tripeptides in stimulating fibronectin and elastin simultaneously. It is frequently reported in comparisons regarding ECM organization, showing an ability to improve skin elasticity metrics in clinical correlates.

Acetyl-Arg-Lys-Arg-Arg-NH2, often modified as a lipopeptide, upregulates Fibulin-5 (FBLN5) and elastin expression by 18-22% in keratinocyte-fibroblast co-cultures.

98 claims

This approach focuses on the assembly of elastic fibers rather than just tropoelastin synthesis. By upregulating Fibulin-5, the peptide assists in the proper cross-linking and organization of elastin, which is quantitatively measured via immunofluorescence intensity in 3D skin models.

Scrambled sequences, specifically Val-Val-Gly-Pro-Gly-Ala (VVGPGA) and Gly-Ala-Val-Pro-Gly-Val, consistently function as inactive negative controls with <5% change in elastin promoter activity.

85 claims

These sequences are critical for validating the specificity of VGVAPG and other elastin-mimetic peptides. Quantitative assays confirm that despite maintaining similar hydrophobicity and amino acid composition, the alteration in primary sequence prevents receptor binding, resulting in biological classifications of 'inactive' or 'non-significant'.

Lipid conjugation (Palmitoylation) significantly enhances peptide potency and reduces the effective concentration threshold for tropoelastin induction in dermal fibroblasts compared to free peptide analogs.

5 claims

Pal-KTTKS vs KTTKS: Palmitoyl-KTTKS induces significant tropoelastin synthesis at 5 ppm (approx. 5-8 μM), whereas the free peptide KTTKS requires concentrations >500 ppm to achieve comparable gene upregulation.

Mechanism: Increased lipophilicity allows for cell membrane penetration and intracellular signaling efficacy not present in hydrophilic free peptides.

Sequence specificity for VGVAPG variants is absolute regarding Elastin Binding Protein (EBP) activation; scrambled sequences serve as confirmed inactive negative controls.

5 claims

VGVAPG (Active): Stimulates fibroblast proliferation and elastin mRNA expression by 120-150% relative to control at 10^-6 M.

VVGPGA (Negative Control): Scrambled sequence consistently results in baseline activity (98-102% of control), confirming that elastin feedback regulation is strictly sequence-dependent.

Copper complexation (GHK-Cu) alters the qualitative outcome of elastin stimulation compared to the free peptide (GHK) by enabling enzymatic cross-linking.

4 claims

GHK (Free Peptide): Upregulates Tropoelastin mRNA and protein levels but results in low levels of mature, insoluble elastin due to lack of LOX cofactor.

GHK-Cu (Complexed): Increases accumulation of insoluble elastin matrix by >30% compared to GHK alone, as Cu2+ acts as an obligate cofactor for Lysyl Oxidase (LOX) mediated cross-linking.

Peptide efficacy in elastin stimulation displays a biphasic dose-response curve, where exceeding optimal concentrations leads to receptor saturation or down-regulation.

4 claims

Optimal Concentration: Peptides like Acetyl-Tetrapeptide-2 show peak elastin stimulation (up to +45%) at concentrations between 0.5 and 5 μg/mL.

High Concentration Inhibition: At concentrations >50 μg/mL, elastin production drops to baseline or slightly below (-5%), suggesting a feedback inhibition mechanism common in matrikines.

Differential activity of Acetyl-Dipeptide-1 Cetyl Ester is observed based on the mechanical environment of the fibroblast culture.

3 claims

Stressed vs Relaxed Matrix: Induction of elastin fiber formation is 2-fold higher in mechanically stressed collagen lattices compared to floating/relaxed lattices, indicating efficacy is modulated by mechanotransduction pathways.

Quantitative Outcome: +60% elastin fiber density in tensioned models vs +25% in static monolayer cultures.

Elastin-derived hexapeptide VGVAPG exhibits a paradoxical 'pro-aging' effect at high concentrations (>50 μg/mL) by upregulating MMP-12 and elastase activity, despite promoting tropoelastin synthesis at lower physiological concentrations (0.1–10 μg/mL).

3 claims

Practitioners typically assume that peptides derived from the target protein (matrikines) function solely as feedback agonists to stimulate repair. It is counter-intuitive that the same sequence used to signal elastin production can, upon reaching a concentration threshold, trigger the Elastin Binding Protein (EBP) to initiate proteolytic degradation and inflammation.

Standard Palmitoyl-KTTKS (Matrixyl), while increasing Collagen I by ~210%, showed statistically insignificant or negligible stimulation of tropoelastin expression in dermal fibroblasts compared to specific dipeptides (e.g., Acetyl-dipeptide-1 cetyl ester) which increased elastin fiber formation by over 400%.

3 claims

Palmitoyl-KTTKS is widely regarded as the 'gold standard' broad-spectrum remodeling peptide. It is unexpected that it displays such high specificity for collagen with virtually no impact on elastogenesis, challenging the assumption that collagen-boosting peptides automatically support the full ECM network.

Copper-complexed peptides (GHK-Cu), despite improving overall skin density, resulted in disorganized, non-functional elastin aggregation (elastotic-like material) rather than physiological fiber assembly when manganese was not co-supplemented.

2 claims

Copper is traditionally viewed as the primary cofactor for lysyl oxidase (LOX) activity. It is surprising that increasing LOX activity via Copper alone without Manganese (essential for correct fiber cross-linking spacing) leads to clumped, amorphous elastin rather than the expected organized fibrillar network.

Scrambled control sequences (e.g., VVGPGA), intended as inactive negative controls, demonstrated 15-20% stimulation of elastin synthesis in 3 distinct fibroblast assays, preventing the establishment of a clear 'zero' baseline.

2 claims

Negative controls are fundamentally assumed to be biologically inert due to lack of receptor fit. Finding that mere hydrophobic amino acid clustering (regardless of precise sequence) can induce mild elastin expression challenges the strict 'lock-and-key' receptor theory for ECM stimulation.

Reporting of inactive, non-stimulatory, or 'failed' peptide sequences (negative data)

Scientific literature and patent claims suffer from significant positive publication bias, rarely publishing sequences that failed to stimulate elastin. This absence creates a critical class imbalance for machine learning model training, preventing the establishment of accurate decision boundaries between bioactive and inert structural motifs.

Differentiation between Tropoelastin (mRNA/monomer) and Mature Cross-linked Elastin

Many claims rely solely on ELN mRNA expression or soluble tropoelastin levels without quantifying desmosine/isodesmosine cross-links or elastic fiber formation. This gap limits the ability to classify a peptide as truly 'elastogenic,' as increased monomer production does not guarantee the assembly of functional, resilient elastic fibers in the extracellular matrix.

Precise characterization of N- and C-terminal modifications for proprietary trade names

Commercial peptides are often reported by trade name or core sequence (e.g., 'Pentapeptide-4') without detailing critical modifications like N-palmitoylation, acetylation, or amidation. Since these modifications dictate lipophilicity, stability, and skin penetration, their omission prevents accurate quantitative comparisons of potency and bioavailability between sequences.

Full dose-response curves and calculated EC50 values

Most quantitative results provide activity at a single arbitrary concentration (e.g., 'increased elastin by 20% at 10ppm') rather than full dose-response curves. This prevents the calculation of EC50 values, making it impossible to objectively rank the potency of different sequences or determine the optimal therapeutic window.

Standardized benchmarking against known positive controls (e.g., TGF-beta, Retinol)

Assays frequently lack head-to-head comparisons with established elastin promoters under identical conditions. Without these internal standards, it is difficult to normalize quantitative results across different studies or experimental models to determine if a novel sequence represents a clinically meaningful improvement over existing standards.

Document	Claims
3D Printed Hollow Microneedles for Treating Skin Wrinkles Using Different Anti-Wrinkle Agents A Poss 2023 The document is a review of anti-wrinkle agents and their delivery. Anti-wrinkle strategies fundamentally rely on targeting and stimulating collagen and elastin production, which is the direct focus... 2 claims
AG-9, an Elastin-Derived Peptide, Increases In Vitro Oral Tongue Carcinoma Cell Invasion, through an 2020 The document identifies, synthesizes, and quantifies the biological activity (cell invasion, MMP secretion) of a specific, defined elastin-derived peptide sequence (AG-9: AGVPGLGVG). Although the... 3 claims
A Clinical Study on Anti-wrinkle Efficacy of a Cosmetics Containing Oligoarginine Conjugation of Pal 2021 · Journal of Computer and Mathematics Education The document reports on a specific, modified peptide sequence, Palmitoyl-GHK-R4 (Pal-GHK-RRRR). The introduction explicitly links the GHK sequence to stimulating the synthesis of extracellular matrix... 2 claims
A Collagen Supplement Improves Skin Hydration, Elasticity, Roughness, and Density Results of a Rando 2019 The document investigates a collagen peptide blend that results in a significant quantitative improvement in skin elasticity (measured via cutometry) in human subjects. Improved elasticity is... 2 claims
A Comprehensive Review on Nutraceuticals Therapy Support and Formulation Challenges. 2022 The document is a comprehensive review on nutraceuticals. Many peptides are used as nutraceuticals or cosmeceuticals for anti-aging and skin health. It is highly probable that this review includes... 1 claim
A Comprehensive Review on the Valorization of Bioactives from Marine Animal By-Products for Health-P 2025 · Cosmetics. Mar. The document is a comprehensive review covering marine-derived bioactives, including peptides, for 'health-promoting, biofunctional cosmetics' with anti-aging/anti-wrinkle properties. Elastin... 2 claims
A Face Serum Containing Palmitoyl Tripeptide-38, Hydrolyzed Hyaluronic Acid, Bakuchiol and a Polyher 2021 · Journal of Cosmetics The document investigates a specific modified peptide, Palmitoyl Tripeptide-38 (Palmitoylation confirmed), as a component of a serum tested for improving skin quality. The study explicitly measures... 2 claims
A Fully Automatic and Efficient Methodology for Peptide Activity Identification Using Their 3D Confo The document focuses entirely on analyzing the 3D conformations of 'elastin-derived peptides (EDP)' specifically to 'identify the ''signature'' that can be linked to a biological activity.' This... 3 claims
A Novel Approach for Screening Sericin-Derived Therapeutic Peptides Using Transcriptomics and Immuno 2023 · Immunoprecipitation. Int. The document describes a novel method for screening therapeutic peptides (TS263 and TS1000) derived from sericin. The abstract and keywords explicitly state that these peptides were screened for... 3 claims
A Self-Propagating Matrix Metalloprotease-9 (MMP-9) Dependent Cycle of Chronic Neutrophilic Inflamma 2011 · PLOS ONE The document provides detailed quantitative data (sequence: Ac-PGP; modification: N-acetyl; concentration, cell type, assay) on a biologically active tripeptide derived from Extracellular Matrix... 3 claims
A Unique Acylated Flavonol Glycoside from i Prunus persica i (L.) var. Florida Prince A New Solid Li 2021 The core study investigates non-peptide compounds (flavonol glycosides). However, the research goal explicitly includes capturing data on peptide sequences used as controls or inactive sequences. The... 1 claim
A chronological history of heart valve prostheses to offer perspectives of their limitations. Santo. Av. The document is a review on heart valve prostheses and tissue engineering. It explicitly mentions 'elastin' as a key component of native heart valves. It is highly probable that later sections... 1 claim
A functional chitosan-based hydrogel as a wound dressing and drug delivery system in the treatment o The document is a review on drug delivery systems (DDS) using hydrogels for wound healing, explicitly mentioning the delivery of 'peptides' to accelerate tissue regeneration and remodeling. Tissue... 2 claims
A review of the current state of natural biomaterials in wound healing applications This document reviews natural biomaterials and bioactive agents used in wound healing and skin tissue engineering. Since elastin is a critical component of the dermal ECM regenerated during wound... 1 claim
Ac-SDKP Attenuates Activation of Lung Macrophages and Bone Osteoclasts in Rats Exposed to Silica by The document investigates a specific modified peptide, N-acetyl-seryl-aspartyl-lysyl-proline (Ac-SDKP). The results explicitly state that Ac-SDKP 'maintained the lung elastin level,' providing a... 2 claims
Acetyl Hexapeptide-8 in Cosmeceuticals—A Review of Skin Permeability and Efficacy 2025 · Efficacy. Int. The document is a review focusing on Acetyl Hexapeptide-8 (a specific modified peptide sequence) and its efficacy, explicitly reporting that clinical studies indicate it improves 'skin elasticity.'... 3 claims
Active Peptides and Motifs within Collagen and Other ECM Proteins 2023 · Journal of Molecular Biology The document is a review summarizing active peptides derived from ECM proteins, including collagen and elastin. It explicitly mentions at least one fragment (SMM, or the fragment containing it) that... 2 claims
Adhesive hydrogels in osteoarthritis from design to application 2023 The document reviews adhesive hydrogels and 'bioactive therapeutic strategies' using 'functional additives' for cartilage regeneration (osteoarthritis). While focused on cartilage ECM... 2 claims
Advancements in Hydrogels A Comprehensive Review of Natural and Synthetic Innovations for Biomedical 2025 This is a comprehensive review on hydrogels used in tissue engineering and regenerative medicine. The document explicitly mentions incorporating 'bioactive peptides' into hydrogel matrices and the... 2 claims
Advancements in microneedle-based drug delivery systems A painless revolution in transdermal medicin 2024 The document reviews microneedle-based drug delivery systems for delivering large biologics (which includes peptides) transdermally into the dermis. The text explicitly mentions the dermis contains... 3 claims
Advantages of Hyaluronic Acid and Its Combination with Other Bioactive Ingredients in Cosmeceuticals 2021 This review focuses on cosmeceuticals and explicitly states it presents additional biological effects due to other active ingredients, including 'peptides' and 'proteins.' Given that the document... 2 claims
Age-Related Changes in the Mechanical Properties of Human Fibroblasts and Its Prospective Reversal A 2013 The document identifies a specific peptide sequence (Palmitoyl-lysyl-valyl-lysine) and its modification, tested on human dermal fibroblasts. It provides explicit concentration details and a... 3 claims
Aging Skin and Anti-aging Strategies The document is a review covering skin aging and anti-aging strategies. Given that the loss of elastin fibers is a central topic, it is highly likely this review discusses or references specific... 2 claims
Algae Metabolites in Cosmeceutical An Overview of Current Applications and Challenges. 2020 The document is a review focused on marine algae metabolites for cosmeceutical applications, specifically mentioning anti-aging effects. Since elastin stimulation is a key mechanism in anti-aging, it... 1 claim
An Overview of the Beneficial Effects of Hydrolysed Collagen as a Nutraceutical on Skin Properties S The document reviews the effects of hydrolysed collagen, which consists of small peptides, on skin properties including elasticity. Elastin is explicitly mentioned as a key component of elasticity.... 2 claims
An Updated Etiology of Hair Loss and the New Cosmeceutical Paradigm in Therapy Clearing ‘the Big Eig 2023 The document reviews the cosmeceutical paradigm for hair loss, listing 'bioactive peptides' as key therapeutic agents used to address the 'big eight strikes,' including 'fibrosis' (scarring/ECM... 3 claims
Anti-Aging Potential of Substance P-Based Hydrogel for Human Skin Longevity 2019 The document investigates the anti-aging potential of a specific peptide (Substance P) by quantifying its effect on extracellular matrix (ECM) components in human dermal fibroblasts (HDFs). While the... 3 claims
Anti-Aging and Depigmentation Effect of a Hyaluronic Acid Mechanically Stabilized Complex on Human S 2023 The document investigates a complex containing specific amino acids (cysteine, glycine, lysine, proline, valine) and an oligopeptide, glutathione (a tripeptide sequence), and explicitly reports its... 2 claims
Anti-Inflammatory and Anti-Thrombogenic Properties of Arterial Elastic Laminae 2023 This review focuses on the physiological function (anti-inflammatory, anti-thrombogenic) and molecular structure of arterial elastic laminae (elastin). While it does not list specific synthetic... 1 claim
Anti-inflammation activities of mycosporine-like amino acids (MAAs) in response to UV radiation sugg 2014 The document investigates the anti-skin aging activity of Mycosporine-Like Amino Acids (MAAs) and explicitly reports that MAAs (mycosporine-Gly, shinorine, and porphyra-334) increase the expression... 2 claims
Anti-aging and Sunscreens Paradigm Shift in Cosmetics This is a review article focusing on anti-aging strategies in cosmetics, mechanisms of skin aging (including the loss of elastin and collagen), and a review of relevant patents. It is highly likely... 1 claim
Antioxidant Biomaterials in Cutaneous Wound Healing and Tissue Regeneration A Critical Review 2023 The document is a critical review on biomaterials used for cutaneous wound healing and tissue regeneration, which inherently involves the restoration of the dermal matrix, including collagen and... 2 claims
Antioxidant and anti-aging potential of a peptide formulation (Gal sub 2 sub -Pep) conjugated with g The document reports the synthesis and testing of a specific peptide sequence, (galloyl)2–KTPPTTP, and explicitly states that it exhibited an 'elastase inhibitory effect' in human fibroblast cells... 3 claims
Antiproliferative Effect of Elastin-Derived Peptide VGVAPG on SH-SY5Y Neuroblastoma Cells 2019 The document investigates the bioactivity (antiproliferative, ROS modulation) of the core elastin-derived peptide sequence VGVAPG, and explicitly mentions the use of the inactive control sequence... 3 claims
Antirid peptides in cosmeceutical formula The document is a review on antirid peptides used in cosmeceuticals. It explicitly details the sequences and modifications (e.g., Pal-KTTKS, VGVAPG) of peptides that stimulate or modulate elastin... 3 claims
Application of Bio-Active Elastin-like Polypeptide on Regulation of Human Mesenchymal Stem Cell Beha 2022 The document investigates bioactive Elastin-Like Polypeptides (ELPs) fused with specific peptide sequences (RGD, YIGSR) and analyzes their effects on human cells (MSCs, fibroblasts). It reports... 3 claims
Application of Synthetic Peptides to Improve Parameters of Skin Physiology An Open Observational 30- 2020 · Journal of Cosmetics The document investigates synthetic peptides (SH-Oligopeptide-1, -2, SH-Polypeptide-1, -42) applied topically to human skin and reports a specific quantitative outcome: an 11.8% increase in skin... 3 claims
Application of Nano-Inspired Scaffolds-Based Biopolymer Hydrogel for Bone and Periodontal Tissue Reg 2022 This is a comprehensive review on scaffolds and functionalization using 'active biomolecules' (including proteins/peptides) for bone and periodontal tissue regeneration. Periodontal ligament... 2 claims
Applications of Engineering Techniques in Microvasculature Design. 2021 · Frontiers in Cardiovascular Medicine The document is a review focused on tissue engineering and microvasculature design, specifically highlighting the potential of using 'elastin-derived materials' and 'elastin' as matrix components and... 1 claim
Applying Seaweed Compounds in Cosmetics, Cosmeceuticals and Nutricosmetics 2021 · Nutricosmetics. Mar. This review summarizes bioactive compounds, including peptides, from seaweeds used in cosmetics/cosmeceuticals for skin care. Anti-aging and anti-wrinkling activities are discussed, and the text... 1 claim
Arginine Gemini-Based Surfactants for Antimicrobial and Antibiofilm Applications Molecular Interacti 2023 The research goal seeks peptides with elastin-stimulating activity. This document evaluates arginine-based surfactants (amino acid derivatives/modifications) for their inhibitory activity against key... 3 claims
Ascorbic Acid (Vitamin C) as a Cosmeceutical to Increase Dermal Collagen for Skin Antiaging Purposes 2022 The document primarily focuses on Ascorbic Acid and collagen production, not elastin. However, it specifically mentions experimental findings on the effectiveness of small amino acid analogs (like... 2 claims
Atherosclerosis and Matrix Dystrophy Journal of Atherosclerosis and Thrombosis The document explicitly reports the activity classification for a specific elastin-derived peptide sequence (VPGVG), stating that it enhanced smooth muscle cell proliferation and resulted in the... 1 claim
Avellanin A Has an Antiproliferative Effect on TP-Induced RWPE-1 Cells via the PI3K-Akt Signalling P 2024 · Pathway. Mar. The document investigates the cyclic pentapeptide Avellanin A (sequence: Ant-L-Pro-D-Ala- N-Me-D-Phe-L-Ile) and reports its quantitative outcomes (IC50 0.72 µM) and mechanism, which involves... 3 claims
Beneficial effects of food supplements based on hydrolyzed collagen for skin care (Review). The document is a review concerning bioactive peptides (collagen hydrolyzate) used to treat skin aging, explicitly mentioning the loss of elastin and collagen. The biological domain (peptides... 2 claims
Bioactive Peptides Applications and Relevance for Cosmeceuticals 2018 The review explicitly addresses bioactive peptides used for 'stimulating collagen and elastin synthesis.' It specifically names and provides the sequence and modification for a known... 1 claim
Bioactive Compounds for Skin Health A Review. 2021 This document is a comprehensive review on bioactive compounds for skin health, including a focus on elasticity and anti-aging. It explicitly mentions 'protein peptides' as functional ingredients... 1 claim
Bioactive Peptides Synthesis, Sources, Applications, and Proposed Mechanisms of Action 2022 · Action. Int. The document is a comprehensive review article on bioactive peptides, explicitly listing applications including anti-aging effects. Elastin-stimulating peptides are a critical component of anti-aging... 2 claims
Bioactive extracellular matrix fragments in lung health and disease. Journal of Clinical Investigation The document is a review focusing on specific bioactive peptides (matrikines) derived from ECM degradation (including collagen and elastin) in the lung. It identifies and characterizes specific... 2 claims
Bioactive potential of natural biomaterials identification, retention and assessment of biological p 2021 The document is a review article on the bioactive potential of natural polymers, explicitly naming elastin and collagen. It discusses the importance of identifying and preserving bioactive motifs,... 3 claims
Bioengineered dynamic systems based on elastin-like recombinamers The document focuses on Elastin-Like Recombinamers (ELRs), which are synthetic peptides based on elastin sequences (VPGVG repeats). Chapters 2 and 3 explicitly detail the synthesis and biological... 2 claims
Biofunctional hydrogels based on elastin-like recombinamers as extracellular matrix analogues The document is a doctoral thesis focused on Elastin-Like Recombinamers (ELRs), which are defined, customized peptide sequences based on elastin. The thesis must detail the specific sequences,... 3 claims
Biological Macromolecule-Based Dressings for Combat Wounds From Collagen to Growth Factors-A Review. 2025 · Review. Med. Sci. The document is a review focusing on advanced wound dressings incorporating 'therapeutic peptides' and 'growth factors' to accelerate healing and support tissue repair. Because elastin synthesis is a... 3 claims
Biological and Cosmetical Importance of Fermented Raw Materials An Overview The document reviews anti-aging cosmetic ingredients (bioferments) and explicitly mentions 'significantly reducing elastase activity' and protecting 'elastin fibres' from degradation. While it... 3 claims
Biomolecules from Microalgae and Cyanobacteria Applications and Market Survey 2022 · Survey. Appl. Sci. The document is a review covering biomolecules (including peptides/metabolites) from microalgae and cyanobacteria and explicitly mentions their use in cosmetic applications. It is highly probable... 1 claim
Biophysics of ACL Injuries. The document discusses biophysical stimulation using pharmacological agents, including the specific modified tripeptide GHK-Cu (Copper Peptide). Although the document focuses on ACL injuries and... 1 claim
Biopolymer- and Natural Fiber-Based Biomimetic Tissues to Realize Smart Cosmeceuticals and Nutraceut 2023 The document investigates the biological activity of fish collagen polypeptides (FCP) used in cosmeceuticals on aged fibroblasts, including measuring metalloproteinase release and collagen... 2 claims
Biopolymers for Hard and Soft Engineered Tissues Application in Odontoiatric and Plastic Surgery Fie 2011 The document is a review focusing on biopolymers and tissue engineering for soft tissues (skin). Regenerating functional skin requires the synthesis of extracellular matrix components, including... 1 claim
Blocking CD40 Alleviates Th1 and Th17 Cell Responses in Elastin Peptide-Induced Murine Emphysema The document identifies and uses a specific elastin peptide sequence (VGVAPG) to induce a biological response (emphysema/inflammation) in a mouse model at a defined concentration. While the activity... 1 claim
Bruch’s Membrane The Critical Boundary in Macular Degeneration The document focuses on Bruch's Membrane (BrM) and Age-Related Macular Degeneration (AMD). BrM contains a critical elastic layer (elastin), and its degeneration is central to AMD pathology. While the... 1 claim
Calcification of the elastic component the impact on the cardiovascular system 2025 · Front. Cardiovasc. Med. This document is a review focusing on elastin synthesis, assembly, and degradation in the cardiovascular system. Although the primary focus is calcification pathology, reviews on elastin degradation... 2 claims
Calcium and Vitamin D Supplementation with and Without Collagen on Bone Density and Skin Elasticity 2025 · Study. Clin. Pract. The study reports positive quantitative outcomes (up to 12.23% improvement in skin elasticity) attributed to fish-derived collagen peptides in human subjects. Improved elasticity is a direct... 3 claims
Cartilage oligomeric matrix protein is an endogenous β-arrestin-2-selective allosteric modulator of 2021 The document investigates vascular injury and identifies an application where a 'peptidomimetic mimicking the AT1-binding motif of COMP' rescues aortic aneurysms (AAA) in mice. While the mechanism... 3 claims
Cell-Matrix Interactions and Matricrine Signaling in the Pathogenesis of Vascular Calcification 2018 · Frontiers in Cardiovascular Medicine The document is a review focusing on cell-matrix interactions and matricrine signaling, specifically mentioning the 'elastin receptor complex (ERC)' as a key modulator of cell behavior. Matricrine... 2 claims
Characterization of novel interactions with membrane NEU1 highlights new regulatory functions for th 2021 The document investigates the signaling activity of Elastin-Derived Peptides (EDP) through the Elastin Receptor Complex (ERC) in human cells (monocytes, HUVEC). While the measured activity is related... 3 claims
Characterization of the human gelatinase a collagen binding domain The document provides quantitative data on the interaction (binding) of specific defined polypeptide sequences (the recombinant Collagen Binding Domain of MMP-2, rCBD123, including point mutants... 2 claims
Colla Corii Asini regulate collagen regeneration in UV exposure-induced skin photoaging in mice. 2025 The document identifies and experimentally validates a specific peptide sequence (YYTSASGDEMVSLK) derived from Colla Corii Asini (CCA) that promotes collagen regeneration and affects matrix... 3 claims
Collagen Hydrolysate from the Scales of Mozambique Tilapia ( i Oreochromis mossambicus i ) Improve H 2023 · Factors. Mar. The document investigates a complex mixture of peptides (Collagen Hydrolysate) and explicitly reports a positive finding: the up-regulation of 'Elastin' mRNA expression in human dermal papilla cells... 3 claims
Collagen Hydrolysates for Skin Protection Oral Administration and Topical Formulation. 2020 The document is a review on hydrolyzed collagen (peptide mixtures) and their effects on skin properties, including improving skin elasticity and enhancing fibroblast production and extracellular... 1 claim
Collagen Supplements for Aging and Wrinkles A Paradigm Shift in the Fields of Dermatology and Cosmet 2022 The document reviews collagen supplements, which are often composed of peptides, and explicitly mentions their use to improve skin elasticity, which is directly dependent on elastin content. The goal... 2 claims
Collagen like peptide bioconjugates for targeted drug delivery applications The document focuses on Collagen-Like Peptides (CLPs), bioconjugates, and hydrogels for targeted drug delivery and materials science. While the primary focus is not elastin stimulation, CLPs are an... 3 claims
Comprehensive Review of the Latest Investigations of the Health-Enhancing Effects of Selected Proper 2024 This document is a comprehensive review focusing on the anti-aging and skin health effects of Spirulina and Arthrospira microalgae. These microalgae are rich sources of proteins (peptides) and the... 3 claims
Construction of a Collagen-like Protein Based on Elastin-like Polypeptide Fusion and Evaluation of I 2023 The document investigates a fusion protein (hCol-ELP) incorporating an Elastin-Like Polypeptide (ELP). ELP sequences are highly relevant to the research goal, which seeks reported peptide sequences... 2 claims
Contribution of the ELRs to the development of advanced i in vitro i models. The document is a review focused on the rational design and application of Elastin-Like Recombinamers (ELRs), which are engineered peptide-based materials derived from tropoelastin sequences. It... 3 claims
Cosmeceutical Peptides in the Framework of Sustainable Wellness Economy 2020 · Frontiers in Chemistry This mini-review focuses on classifying and reporting the activity of cosmeceutical peptides used for anti-aging. The text explicitly mentions regulating 'structural protein synthesis and... 2 claims
Current Approaches in Cosmeceuticals Peptides, Biotics and Marine Biopolymers 2025 This review directly discusses bioactive peptides used in cosmeceuticals for anti-aging, explicitly mentioning their function in promoting collagen and elastin synthesis. It lists several relevant... 3 claims
Cutaneous Delivery of Cosmeceutical Peptides Enhanced by Picosecond- and Nanosecond-Domain Nd YAG La 2022 The document investigates the delivery of specific cosmeceutical peptides (Palmitoyl tripeptide (PT)-1, PT-38, and Copper tripeptide (CT)-1) known to promote 'collagen and elastin synthesis.' While... 3 claims
Daily consumption of the collagen supplement Pure Gold Collagen® reduces visible signs of aging. The document investigates hydrolyzed collagen supplements, which are composed of peptides. It identifies specific absorbed peptides (e.g., Pro-Hyp) derived from collagen and discusses their effect on... 2 claims
Dermocosmetics in dermatological practice. Recommendations of the Polish Dermatological Society. Par The document is a detailed review and recommendation regarding dermocosmetic active ingredients. It explicitly lists 'peptides' as key components. Given the context of dermatology and cosmeceuticals,... 3 claims
Design and Evaluation of Complex Polypeptide-Loaded Dissolving Microneedles for Improving Facial Wri 2022 The document investigates the anti-wrinkle efficacy of complex polypeptides, including several modified sequences (acetyl hexapeptide-8, palmitoyl pentapeptide-4, palmitoyl tetrapeptide-7,... 3 claims
Design of Bio-Conjugated Hydrogels for Regenerative Medicine Applications From Polymer Scaffold to B 2020 This review focuses on bio-conjugated hydrogels used in regenerative medicine, specifically discussing the choice of biomolecules including peptides, DNA, and proteins. Regenerative medicine... 2 claims
Development and therapeutic assessment of multivalent protein polymers for cancer and eye diseases The document discusses the development and characterization of specific Elastin-like Polypeptides (ELPs) used as protein polymer platforms (e.g., scFv-ELP fusions). ELPs are relevant peptide... 3 claims
Development of Scaffolds from Bio-Based Natural Materials for Tissue Regeneration Applications A Rev 2023 This review focuses on bio-based scaffolds for tissue regeneration, which heavily involves the extracellular matrix (ECM). Since elastin is a critical component of the ECM, the document is highly... 2 claims
Development of novel wound dressing based on elastin-like recombinamers for skin regeneration The document is a PhD thesis focused on 'Elastin-Like Recombinamers' (ELRs) and 'Peptides' (explicitly listed in 2.1.10.2) for skin regeneration. ELRs are peptide-based polymers, and their design... 3 claims
Developments for Collagen Hydrolysate in Biological, Biochemical, and Biomedical Domains A Comprehen 2021 The document is a comprehensive review focusing on collagen hydrolysates, which are proteinic biopeptides. Research on collagen peptides and their biological/biomedical functionalities frequently... 3 claims
Developments in Extracellular Matrix-Based Angiogenesis Therapy for Ischemic Heart Disease A Review 2025 The document reviews developments in Extracellular Matrix (ECM) therapy for tissue repair, specifically mentioning elastic fibers and bioactive peptides known as matrikines derived from ECM... 1 claim
Dietary Collagen Hydrolysates Ameliorate Furrowed and Parched Skin Caused by Photoaging in Hairless 2021 · Mice. Int. The document investigates the effects of a specific tripeptide sequence (Glycine-Proline-Hydroxyproline, GPH) and collagen hydrolysates (fsCH) on the dermal extracellular matrix (ECM), including... 3 claims
Diversity of Bioinspired Hydrogels From Structure to Applications 2023 The document is a comprehensive review covering the diversity of bioinspired hydrogels based on biomolecules, including polypeptides and peptides. These materials are often used in regenerative... 2 claims
Effect of Newly Synthesized Structures of Peptides on the Stability of the Monolayers Formed 2023 · Formed. Int. The document provides specific sequences and modifications for newly synthesized peptides (P2, P4, P5, P6). While it focuses on physicochemical properties (monolayer stability, TG/DTG, DSC), the... 3 claims
Effect of a Topical Collagen Tripeptide on Antiaging and Inhibition of Glycation of the Skin A Pilot 2022 · Study. Int. The document investigates the effects of a Collagen Tripeptide (CTP) on skin elasticity and antiaging. While it focuses heavily on anti-glycation and collagen stimulation, it reports quantitative... 3 claims
Effect of composite biodegradable biomaterials on wound healing in diabetes The document is a review on biodegradable biomaterials combined with 'active substances' (drugs, stem cells, active agents) for diabetic wound healing. Wound healing involves extensive Extracellular... 3 claims
Effect of elastin-derived peptides on the production of tissue inhibitor of metalloproteinase-1, -2, The document provides quantitative data on the effect of a specific elastin-derived peptide, κ-elastin (which targets the VGVAPG sequence), on human endothelial cells across various concentrations... 3 claims
Effect of noncovalent interaction on the self-assembly of a designed peptide and its potential use a Journal of Nanomedicine The document investigates four specific, modified peptide sequences (P1-P4) that incorporate the GVGV tetrapeptide, an abundant repeat found in elastin. The research goal explicitly seeks reported... 3 claims
Effective Active Ingredients Obtained through Biotechnology 2016 This review focuses on biotechnologically derived cosmetic active ingredients, specifically mentioning peptides that stimulate the synthesis of skin extracellular matrix (ECM) components. Elastin is... 3 claims
Effects of Hydrolyzed Collagen as a Dietary Supplement on Fibroblast Activation A Systematic Review. 2024 The document is a systematic review detailing the effects of specific collagen peptides (molecular weight, concentration ranges) on fibroblast activation. Fibroblasts are the cells responsible for... 3 claims
Effects of Maillard reaction and its product AGEs on aging and age-related diseases 2024 The document reviews the Maillard reaction and Advanced Glycation End products (AGEs), which cause non-enzymatic covalent cross-linking and modification of macromolecules like collagen and connective... 2 claims
Effects of Retinol, Natural Pea Peptide and Antioxidant Blend in a Topical Formulation In Vitro and 2024 The document investigates a specific peptide (Pep_RTE62G) isolated from Pisum sativum and explicitly reports that the formulation containing this peptide significantly 'upregulated... elastin' gene... 2 claims
Effects of Semi-Ablative Fractional Radiofrequency Associated with Growth Factors in Stretch Marks A 2021 · Journal of Applied Sciences The document investigates skin treatments (for stretch marks) involving 'active principles' aimed at increasing collagen and elastin levels. Crucially, it specifically mentions the use of... 3 claims
Elasticity Modification of Biomaterials Used in 3D Printing with an Elastin-Silk-like Recombinant Pr 2024 · Funct. Biomater. The document investigates a recombinant protein (EJ17zipR) explicitly constructed from specific elastin-derived peptide sequences (ELPs, e.g., VPAGG, VPAAG, VPAFG) alongside other functional domains... 3 claims
Elastin-Based Materials Promising Candidates for Cardiac Tissue Regeneration 2020 · Frontiers in Bioengineering This review focuses on Elastin-Like Recombinamers (ELRs) and polypeptides (ELPs), which are defined by repetitive VPGVG peptide sequences. The document discusses the specific amino acid sequence and... 3 claims
Elastin-Derived Peptide-Based Hydrogels as a Potential Drug Delivery System 2024 The document identifies, synthesizes, and fully characterizes the structure and modifications (Fmoc- and NH2 termini) of specific elastin-derived peptide sequences. Although the primary tested... 3 claims
Elastin-Derived Peptides in the Central Nervous System Friend or Foe 2021 This is a review focused on Elastin-Derived Peptides (EDPs), explicitly naming key sequences like VGVAPG and Elastin-Like Polypeptides (ELPs). While the context is the Central Nervous System (CNS),... 3 claims
Elastin-Derived VGVAPG Fragment Decorated Cell-Penetrating Peptide with Improved Gene Delivery Effic 2023 The document investigates a peptide (RALA-E) engineered using the critical elastin-derived fragment VGVAPG (Table 1), providing the full sequence and modification (attachment to RALA). Although the... 3 claims
Elastin-Like Polypeptide Nanoparticles as Carriers for Anti-EGFR Peptide Therapeutics The document focuses heavily on Elastin-Like Polypeptides (ELPs) derived from elastin sequences (e.g., VPGVG repeats) and their construction/characterization. Although the primary therapeutic goal is... 3 claims
Elastin-Like Recombinamer Hydrogels for Improved Skeletal Muscle Healing Through Modulation of Macro 2020 · Frontiers in Bioengineering The document details the engineering and characterization of Elastin-Like Recombinamers (ELRs), which are synthetic peptides based on the VPGXG motif found in natural elastin. It reports specific... 3 claims
Elastin-derived peptides (EDPs) as a potential pro-malignancy factor in human leukemia cell lines. 2024 The research goal requires capturing data on specific peptide sequences (VGVAPG and VVGPGA), their outcomes (positive/negative/inconclusive), and full methodological details (sequence, cell type,... 3 claims
Elastin-derived peptides are new regulators of thrombosis. 4432 The document identifies and characterizes the activity of key elastin-derived peptides (EDP), specifically the canonical sequence VGVAPG, providing its concentration, cell type (human/mouse), and... 2 claims
Elastin-like polypeptides as a promising family of genetically-engineered protein based polymers. 2014 The document provides detailed information on the specific peptide sequences that constitute Elastin-Like Polypeptides (ELP), such as the repeating pentapeptide Val–Pro–Gly–Xaa–Gly ([VPGXG]n), and... 2 claims
Elastin Based Constructs The document provides critical biological context, identifies key cell types (SMCs, fibroblasts), and explicitly mentions the VGVAPG peptide sequence, a major active site often utilized or modified... 3 claims
Elastin Structure, Synthesis, Regulatory Mechanism and Relationship With Cardiovascular Diseases 2021 · Frontiers in Cell The document is a review covering Elastin Synthesis and Regulatory Mechanisms. Reviews on regulatory mechanisms often summarize or cite experimental studies detailing specific molecules (including... 3 claims
Elastin in the Liver 2016 · Frontiers in Physiology This is a review focused on elastin biochemistry and physiology, explicitly mentioning tropoelastin structure, repeating motifs (e.g., GVGVAP), and the biological activity of elastin peptides... 3 claims
Elastin peptides in aging and pathological conditions This is a review focused on the nature and role of Elastin Peptides (EPs) and their receptors in tissue homeostasis and pathology. Studies detailing EPs necessarily involve specific sequence... 2 claims
Elastin peptides regulate HT-1080 fibrosarcoma cell migration and invasion through an Hsp90-dependen The document tests specific peptide sequences (VGVAPG, AGVPGLGVG, GRKRK) derived from elastin at defined concentrations (e.g., 200 µg/ml) and reports their activity classification (positive or no... 3 claims
Elastin‑derived peptides are involved in the processes of human temporomandibular disorder by induci The document investigates the bioactivity of elastin-derived peptides (EDPs) on human synovial cells, specifically mentioning the key sequence VGVAPG as the potentially active hexapeptide that binds... 3 claims
Elucidating the Pathogenesis of Pre-eclampsia Using In Vitro Models of Spiral Uterine Artery Remodel 2017 The document explicitly identifies an elastin-derived peptide (matrikine), VGVAPG, and reports its quantitative functional outcome (increased invasion) on SGHPL-4 trophoblast cells using a transwell... 3 claims
Engineered Nanotechnology An Effective Therapeutic Platform for the Chronic Cutaneous Wound 2022 The document is a review on engineered nanotechnology for chronic wound healing and tissue regeneration. Wound healing involves the restoration of the extracellular matrix (ECM), including elastin... 1 claim
Epidermal Growth Factor in Aesthetics and Regenerative Medicine Systematic Review. Journal of Cutaneous and Aesthetic Surgery The document, a systematic review on Epidermal Growth Factor (EGF), discusses a specific polypeptide sequence (EGF) used for skin restructuring. It explicitly states that its mechanism involves... 3 claims
Erythromycin Prevents Elastin Peptide-Induced Emphysema and Modulates CD4+T Cell Responses in Mice Journal of Chronic Obstructive Pulmonary Disease The research goal requires specific peptide sequences tested in elastin research, including inactive controls. This document explicitly identifies and uses a known elastin-derived peptide sequence,... 2 claims
Evaluation of Fluorine-18-Labeled α1(I)-N-Telopeptide Analogs as Substrate-Based Radiotracers for PE 2018 · Frontiers in Chemistry The document investigates peptide sequences (telopeptide analogs) and modifications (F-18 labeling, LYS substitution with ORN/NLE) as substrates for Lysyl Oxidase (LOX). LOX is the critical enzyme... 3 claims
Exploring Greek actinobacterial biodiversity for the discovery of bioactive metabolites with skin an Frontiers in Microbiology The document investigates anti-aging compounds and specifically identifies and tests defined peptide sequences (cyclic dipeptides: Cyclo (L-proline-L-tyrosine) and Cyclo (Pro-Phe)) for activity... 3 claims
Exploring the Impact of Hydrolyzed Collagen Oral Supplementation on Skin Rejuvenation A Systematic R 2017 The document reviews the effects of Hydrolyzed Collagen (HC) oral supplementation on skin elasticity. HC is a mixture of peptides/dipeptides (e.g., containing proline and glycine) derived from... 3 claims
Exploring the Role of Tripeptides in Wound Healing and Skin Regeneration A Comprehensive Review 2016 · Journal of Medical Sciences The document is a review focusing on bioactive tripeptides and their role in skin regeneration and extracellular matrix (ECM) remodeling. The abstract explicitly states that GHK-based formulations... 2 claims
Extracellular EDPs at high concentrations participate in neuronal cytoskeleton assembly and AD etiol The document explicitly identifies specific Elastin-Derived Peptide sequences, (VGVAPG)₃ and the inactive control (VVGPGA)₃, along with quantitative results (CCK-8 cell viability) across a wide range... 3 claims
Extracellular Matrix Molecules Facilitating Vascular Biointegration 2012 · Funct. Biomater. This review focuses on extracellular matrix (ECM) components like tropoelastin and elastin in the context of biomaterials and vascular biointegration. It discusses the use of peptides derived from... 3 claims
Extracellular matrix derived peptides and mesenchymal stem cell motility The document investigates bioactive peptides (matrikines/matricryptins) derived from extracellular matrices, which is the chemical class of interest (elastin peptides are matrikines). It uses mass... 3 claims
Extracellular matrix proteases contribute to progression of pelvic organ prolapse in mice and humans Journal of Clinical Investigation The document investigates the molecular role of Fibulin-5 in elastic fiber assembly (elastogenesis) and maintenance, which is the core domain of the research goal. Specifically, it characterizes the... 3 claims
Fibrillar Self-Assembly of a Chimeric Elastin-Resilin Inspired Engineered Polypeptide. 2019 The document investigates a well-defined, engineered chimeric polypeptide sequence derived from elastin and resilin, and includes preliminary biological testing (cytotoxicity) on human fetal foreskin... 3 claims
Fibrillin-1 and elastin fragmentation in the pathogenesis of thoracic aortic aneurysm in Marfan synd Prof. Dr. The document investigates the role of Fibrillin-1 fragments, specifically those containing the GxxPG consensus sequence, in aortic pathology related to elastin breakdown (Marfan syndrome). The... 3 claims
Fibrous Scaffolds From Elastin-Based Materials 2021 · Frontiers in Bioengineering This review focuses on Elastin-Like Recombinamers (ELRs) and synthetic elastin-based peptides/proteins. The discussion of ELRs requires defining specific repeating peptide sequences (e.g., VPGVG,... 2 claims
Fish Collagen Peptide (NaticolⓇ) Protects the Skin from Dryness, Wrinkle Formation, and Melanogenesi 2007 · Prev. Nutr. The document investigates the anti-wrinkle activity of a fish collagen peptide hydrolysate (NaticolⓇ) in human fibroblasts (Hs27 cells) and provides the quantitative level of a specific internal... 2 claims
Food Peptides for the Nutricosmetic Industry. 2023 This document is a review summarizing bioactive peptides (biopeptides) for the nutricosmetic/anti-aging industry. The introduction explicitly mentions 'signal peptides' that 'stimulate matrix protein... 2 claims
Framing Heartaches The Cardiac ECM and the Effects of Age 2023 · Age. Int. The document is a detailed review of the cardiac Extracellular Matrix (ECM) composition, structure, and remodeling, which includes components essential for elasticity (elastin, collagen). Although... 1 claim
Free and encapsulated stem cells for skin regeneration This is a review on skin regeneration using tissue engineering and stem cells, focusing on restoring the dermal layer which relies heavily on elastin. Reviews in this domain often summarize the use... 2 claims
Functional Vascular Tissue Engineering Inspired by Matricellular Proteins 2019 · Frontiers in Cardiovascular Medicine The research goal seeks peptide sequences that stimulate elastin activity and their quantitative outcomes. This document is a mini-review focused on 'Functional Vascular Tissue Engineering Inspired... 3 claims
Ginseng glycoprotein and ginsenoside facilitate anti UV damage effects in diabetic rats. 2022 · Frontiers in Pharmacology The document investigates a ginseng glycoprotein (a complex polypeptide) in an animal model of skin damage. The introduction explicitly notes that UV rays 'destroy the skin’s collagen and elastin... 3 claims
Glycolytic Reprogramming in Silica-Induced Lung Macrophages and Silicosis Reversed by Ac-SDKP Treatm 2021 · Treatment. Int. The document investigates the N-acetylated peptide, Ac-SDKP, in a lung fibrosis model (silicosis). The introduction explicitly links this disease model to the downregulation of elastin levels.... 2 claims
Heparan sulfates facilitate harmless amyloidogenic fibril formation interacting with elastin-like pe 2018 The document investigates synthetic Elastin-Like Peptides (ELPs) with defined sequences ((VGGVG)n, (LGGVG)n), reporting on their structural properties (aggregation kinetics/fibril formation) and... 3 claims
Histological Changes Associated with Extracellular Matrix-Remodeling Topical Therapy 2017 The document reports positive in vivo (human subjects) results for elastin-stimulating activity (elastogenesis) using a proprietary blend of peptides (TriHex Technology™). It specifically mentions... 1 claim
Hold on or Cut Integrin- and MMP-Mediated Cell–Matrix Interactions in the Tumor Microenvironment 2020 · Microenvironment. Int. The document is a review focusing on the Extracellular Matrix (ECM) and its remodeling, explicitly mentioning elastin and 'elastin degradation peptides (EDPs)' (matrikines). These peptides are often... 2 claims
Hydrogel scaffolds as in vitro models to study fibroblast activation in wound healing and disease Biomater. Sci. The document is a mini-review detailing in vitro hydrogel models used to study fibroblast function, activation, and matrix synthesis/remodeling (ECM production). It explicitly mentions the use of... 3 claims
Hydrolyzed Collagen-Sources and Applications. 2019 The document reviews Hydrolyzed Collagen (HC), which is composed of low molecular weight peptides (3–6 KDa). HC peptides are a major class of compounds studied for skin elasticity and extracellular... 2 claims
Identification and Evaluation of New Potential Inhibitors of Human Neuraminidase 1 Extracted from i 2021 The document focuses on inhibitors of Human Neuraminidase 1 (NEU-1). NEU-1 is explicitly linked to elastin metabolism as it is the catalytic subunit of the Elastin Receptor Complex (ERC), which binds... 1 claim
Identification and Characterization of Novel Matrix-Derived Bioactive Peptides A Role for Collagenas The document identifies and characterizes novel chemically-synthesized bioactive peptides derived from the extracellular matrix (ECM) of human dermal cells (collagen, fibronectin, etc.). It tests... 3 claims
Identification of CD36 as a new interaction partner of membrane NEU1 potential implication in the pr 2018 The document investigates Elastin-Derived Peptides (EDP) and their interaction with the Elastin Receptor Complex (ERC). It explicitly provides the sequence of the inhibitory peptide V14... 3 claims
Immunomodulatory Role of the Extracellular Matrix Within the Liver Disease Microenvironment Frontiers in Immunology The document reviews the Extracellular Matrix (ECM), which includes elastin, and focuses heavily on 'immune-active peptides and domains' derived from ECM remodeling, known as DAMPs (Damage-Associated... 3 claims
Impact of Elastin-Derived Peptide VGVAPG on Matrix Metalloprotease-2 and -9 and the Tissue Inhibitor 2018 The document directly investigates the impact of a key elastin-derived peptide sequence (VGVAPG) on matrix remodeling enzymes (MMPs and TIMPs) in a defined cell type (mouse cortical glial cells)... 3 claims
Impact of elastin-derived VGVAPG peptide on bidirectional interaction between peroxisome proliferato 2018 The document provides precise quantitative data (sequence: VGVAPG, length: 6, cell type: mouse astrocytes, concentrations: 50 nM to 50 µM) regarding the biological activity of a key elastin-derived... 3 claims
Important roles of dietary taurine, creatine, carnosine, anserine and 4-hydroxyproline in human nutr 2020 · Frontiers in Agricultural The document is a review that discusses specific dipeptides (Carnosine, Anserine) and amino acid derivatives (4-hydroxyproline) and explicitly links them to improving 'skin and bone health.' Although... 3 claims
In Vitro Comparative Study of Calcium Hydroxyapatite (Stiim) Conventional Saline Dilution Versus Pol The document investigates the biostimulatory effects of a poly-micronutrient solution containing several specific named bioactive peptides (Matrixyl, Syn-Coll, Syn-Hycan, Syn-TC, Syn-Tacks, Syn-UP,... 3 claims
In Vitro and In Silico Wound-Healing Activity of Two Cationic Peptides Derived from Cecropin D in &l 2025 The document tests specific peptide sequences (cationic peptides derived from Cecropin D) on fibroblasts (Detroit 551 cells) for wound-healing and tissue regeneration activity, providing quantitative... 3 claims
In vitro and in vivo Evaluation on the Safety and Efficacy of a Brand-New Intracutaneous Filler with The document investigates the in vitro efficacy of a formula containing specific dipeptide sequences (AlaPro, ProGly, GlyPro) and key amino acids (Valine, Glycine, Proline) for stimulating... 3 claims
In vivo reprogramming of murine cardiac fibroblasts into induced cardiomyocytes. The document explicitly tests and provides quantitative outcomes for a specific named peptide sequence, Thymosin β4 (Tβ4), described as a 'fibroblast activating peptide.' While the main outcome... 2 claims
Inclusion of Cross-Linked Elastin in Gelatin PEG Hydrogels Favourably Influences Fibroblast Phenotyp 2020 The document provides quantitative results (6-fold increase in elastin expression at day 9) and activity classification regarding elastin synthesis (elastin-stimulating activity) by Normal Human... 3 claims
Induction of MMP-9 release from human dermal fibroblasts by thrombin involvement of JAK STAT3 signal 2007 The document tests two explicit, short, modified peptide sequences (SFLLR-NH2, RLLFS-NH2) on human dermal fibroblasts (HDFs) and provides quantitative data on their ability to induce MMP-9 release.... 3 claims
Influence de l'élastolyse dans la physiopathologie gingivale The document provides explicit peptide sequences (VGVAPG, VGVAPG3, kappa-elastin), specific concentrations (100 µg/ml, 200 µg/ml), cell type (human gingival fibroblasts), and quantitative results... 3 claims
Infraorbital Dark Circles A Review of the Pathogenesis, Evaluation and Treatment Journal of Cutaneous and Aesthetic Surgery The document is a review on the pathogenesis and treatment of periorbital aging, which explicitly mentions 'loss of elasticity and turgor as a result of collagen and/or elastin loss.' The document... 2 claims
Injectable Gelatin–Palmitoyl–GDPH Hydrogels as Bioinks for Future Cutaneous Regeneration Physicochem 2024 The document investigates a modified peptide sequence, Palmitoyl–GDPH (palmitic acid–glycine–aspartic acid–proline–histidine), used in a context (cutaneous regeneration, Human Dermal Fibroblasts)... 3 claims
Innovative Approaches to an Eco-Friendly Cosmetic Industry A Review of Sustainable Ingredients 2024 This document is a review of sustainable cosmetic ingredients. The goal focuses on peptide sequences stimulating elastin. Cosmetic ingredients frequently include anti-aging peptides targeting the... 1 claim
Insights into preclinical models of calcific aortic valve disease and their translational potential 2025 · Front. Cardiovasc. Med. The document is a review of preclinical models and mechanisms for Calciîc Aortic Valve Disease (CAVD). CAVD involves significant extracellular matrix (ECM) remodeling, and the document explicitly... 1 claim
Insights into Bioactive Peptides in Cosmetics 2023 This document is a review article on bioactive peptides in cosmetics, which explicitly discusses the classification and mechanisms of action of peptides. It specifically addresses 'elastin'... 2 claims
Interaction Between Aging-Related Elastin-Derived Peptide (VGVAPG) and Sirtuin 2 and its Impact on F 2024 The document provides sequence (VGVAPG), cell type (SH-SY5Y), concentration/methodology (implied by M&M), and detailed quantitative outcomes (e.g., 52.69% decrease in ROS) for a known elastin-derived... 2 claims
Interaction between the antagonist of the N-methyl-D-aspartate receptor (NMDAR) and elastin-derived The document investigates the biological activity of the key elastin-derived peptide VGVAPG (sequence and concentrations provided) and links its mechanism (AhR expression) to extracellular matrix... 3 claims
Iontophoretic Delivery of Hyaluronic Acid Nanogel-Loaded Fermented Rice Extract Mitigates Skin Glyca The document investigates mitigating skin glycation, a process known to damage and degrade elastin fibers, resulting in loss of elasticity. Although it focuses on an extract (Fermented Rice Extract)... 3 claims
Laminin receptor initiates bacterial contact with the blood brain barrier in experimental meningitis Journal of Clinical Investigation The document investigates the Laminin Receptor (LR), which it explicitly states binds basement membrane components, including elastin. It then uses defined synthetic LR peptides (263–282 and 161–182,... 2 claims
Liposome Encapsulation of the Palmitoyl–KTTKS Peptide Structural and Functional Characterization 2024 The document studies the modified peptide pal-KTTKS and provides structural details (sequence, modification) and quantitative functional outcomes (concentration, cell type, assay method, results)... 3 claims
Liposomes as Carriers of GHK-Cu Tripeptide for Cosmetic Application 2023 The document investigates the copper tripeptide GHK-Cu (Glycyl-L-histidyl-L-lysine complexed with copper) which is explicitly noted as stimulating elastin synthesis in the introduction. Crucially,... 3 claims
Longevity-Promoting Pathways and Transcription Factors Respond to and Control Extracellular Matrix D The document is a review focusing extensively on Extracellular Matrix (ECM) remodeling, aging, and longevity pathways (mTOR, FOXO, Nrf2). While it focuses on genetic and signaling regulation rather... 1 claim
Lysyl Oxidase Enhances the Deposition of Tropoelastin through the Catalysis of Tropoelastin Molecule 2017 · Biol. Pharm. Bull. The document investigates the mechanism of tropoelastin deposition and assembly in relevant human dermal fibroblast cell lines (NHDF-neo, NHDF-Ad), mentioning specific endogenous elastin repeat... 3 claims
Macrofungal Extracts as a Source of Bioactive Compounds for Cosmetical Anti-Aging Therapy A Comprehe 2024 The review focuses on bioactive compounds from macrofungal extracts used for anti-aging therapy. The abstract explicitly states these compounds include 'polysaccharide peptides' and work by... 1 claim
Macrophage-extracellular matrix interactions Perspectives for tissue engineered heart valve remodeli 2022 · Frontiers in Cardiovascular Medicine The document is a review focusing on extracellular matrix (ECM) remodeling and tissue engineering, specifically mentioning the critical role of elastin fibers in heart valve structure. The scope... 3 claims
Marine Macroalgae in Topical Formulations Bioactive Compounds, Variability, Analytical Challenges an 2025 The document is a review focusing on macroalgae-derived bioactive compounds, explicitly mentioning 'peptides' and their documented 'anti-aging activity' and 'skin benefits' in topical formulations.... 2 claims
Matrikines are key regulators in modulating the amplitude of lung inflammation in acute pulmonary in 2015 The document investigates bioactive matrix fragments (matrikines) derived from ECM degradation, specifically characterizing the tripeptide sequence PGP (Proline–Glycine–Proline). Although the primary... 3 claims
Matrix- and plasma-derived peptides promote tissue-specific injury responses and wound healing in di 2016 The document investigates novel, short, protease-resistant peptides (Comb1 and UN3) derived from extracellular matrix fragments that promote dermal matrix remodeling, including the upregulation of... 3 claims
Matrix Metalloproteinases Inhibitors in Cancer Treatment An Updated Review (2013-2023). 2023 The document reviews Matrix Metalloproteinases (MMPs), including metalloelastase (MMP-12, MMP-2, MMP-9, MMP-13) which degrade elastin. Although the focus is on MMP inhibitors (MMPi) for cancer, the... 2 claims
Matrix Metalloproteinases in Chronic Obstructive Pulmonary Disease 2023 · Disease. Int. The document reviews Matrix Metalloproteinases (MMPs), which are the primary agents of elastin degradation. It discusses MMPs as therapeutic targets. If the review includes data on peptide sequences... 1 claim
Mechanisms on How Matricellular Microenvironments Sustain Idiopathic Pulmonary Fibrosis 2025 · Fibrosis. Int. The document is a review focusing on the mechanisms of extracellular matrix (ECM) remodeling, fibroproliferation, and matrix synthesis (by fibroblasts/myofibroblasts) in idiopathic pulmonary fibrosis... 3 claims
Mesenchymal Stromal Cells Combined With Elastin-Like Recombinamers Increase Angiogenesis In Vivo Aft The document uses and details specific Elastin-Like Recombinamers (ELRs) containing highly relevant core peptide sequences derived from elastin structure (VPGXG repeats) and bioactive domains (RGD,... 3 claims
Microbial Fermentation of Industrial Rice-Starch Byproduct as Valuable Source of Peptide Fractions w 2020 The document investigates peptide fractions derived from microbial fermentation for 'health-related activity' and 'anti-aging effects.' Crucially, the Materials section explicitly lists the use of... 3 claims
Microfibril-associated glycoprotein 4 forms octamers that mediate interactions with elastogenic prot 2024 The document investigates the structure and function of MFAP4, a glycoprotein critical for elastogenesis, and reports on its direct interactions with tropoelastin and fibrillin-1, including its role... 3 claims
Microneedles-A new paradigm in transdermal delivery of therapeutic agents The document reviews microneedles for transdermal drug delivery, explicitly mentioning the delivery of 'peptides' and discussing mechanisms of 'dermal regeneration' and 'neocollagenesis' (tissue... 2 claims
Modification Strategies for Ionic Complementary Self-Assembling Peptides Taking RADA16-I as an Examp 2022 This review summarizes modification strategies for self-assembling peptides (like RADA16-I) using 'active motifs derived from the active domain of the extracellular matrix' for use in regenerative... 1 claim
Modification of Alginates to Modulate Their Physic-Chemical Properties and Obtain Biomaterials with 2021 This document is a review focusing on the functionalization of alginates using natural and synthetic peptides to obtain biomaterials with diverse biological activity for regenerative medicine... 3 claims
Modular and orthogonal synthesis of hybrid polymers and networks. 4545 This is a review on the modular synthesis of hybrid biomaterials (including peptides/proteins) for 3D cell culture and tissue engineering, which is the adjacent domain where peptides are screened for... 2 claims
Molecular Mechanisms of Dermal Aging and Antiaging Approaches. 2019 This is a comprehensive review on dermal aging and antiaging approaches. Antiaging approaches, particularly topical treatments discussed in such reviews, commonly include specific peptides designed... 2 claims
Molecular Research on Oral Diseases and Related Biomaterials A Journey from Oral Cell Models to Adva 2022 · Perspectives. Int. This is a review focused on regenerative perspectives and biomaterials for oral tissues. It explicitly mentions 'antimicrobial peptides' and discusses tissue remodeling and mechanotransduction. Given... 3 claims
Molekulare und klinische Untersuchungen beim Marfan-Syndrom und verwandten Erkrankungen Prof. Dr. The document focuses on the molecular pathology of Marfan Syndrome (Fibrillin-1 mutations), which is fundamentally a disease of elastic fibers and their scaffolding. Section 2.3/3.3 specifically... 2 claims
Multifunctional biomaterial platforms for blocking the fibrosis process and promoting cellular resto 2022 · Frontiers in Bioengineering This document reviews biomaterial platforms for myocardial fibrosis therapy, which focuses on regulating and restoring the extracellular matrix (ECM). Given that elastin is a critical ECM component... 3 claims
Nanomaterials in Wound Healing and Infection Control. 2021 The document is a review on nanomaterials in wound healing. Wound healing inherently involves the proliferation phase where 'fibroblasts proliferate and elastin is produced' (Section 2.2).... 1 claim
Natural and Genetically Engineered Proteins for Tissue Engineering. 2011 Review covers natural and genetically engineered proteins and peptides (including self-assembling peptides and bioactive domains) for tissue engineering. Elastin-like polypeptides (ELPs) and peptides... 2 claims
Natural biopolymer-based hydrogels as designer matrices for organoid cultures The document, a review on hydrogels for organoid culture, explicitly categorizes and discusses peptides as natural biopolymers used for designing artificial extracellular matrices (ECM). Although it... 3 claims
Non-invasive in vivo imaging of changes in Collagen III turnover in myocardial fibrosis. The research goal explicitly requests capturing quantitative results for peptide sequences tested against elastin activity, including inactive controls. Supplementary Figure 2 provides quantitative... 2 claims
Nonprescription Topical Treatments for Skin Rejuvenation The document reviews nonprescription treatments and explicitly names a specific, modified peptide complex, GHK-Cu (glycyl-L-histidyl-L-lysine-Cu2+), used for enhancing the dermal layer and augmenting... 3 claims
Novel Hydrogel-forming elastin-like recombinamers for biomedical applications The document is a doctoral thesis focused on Elastin-Like Recombinamers (ELRs), which are synthetic protein polymers based on defined elastin peptide sequences. The index indicates detailed reporting... 3 claims
Oligomeric hyaluronic acid-modified liposomes effectively improved skin permeability and anti-ageing The document explicitly uses 'acetyl hexapeptide-8' as a positive control in a study measuring the upregulation of the elastin gene in zebrafish. The research goal requires capturing known peptide... 2 claims
Optimization of extraction and purification of the M protein fused GCN4pII motif and elastin like po 2024 · Journal of Biotechnology The document utilizes and defines an Elastin-Like Polypeptide (ELP) consisting of repeating VPGXG pentapeptides derived from elastin. Although the primary research focus is vaccine production and... 3 claims
Oral Collagen Peptides and Vulvovaginal Radiofrequency Therapy for Genitourinary Syndrome of Menopau 2025 · Clin. Med. The document investigates specific 'bioactive collagen peptides (BCPs®)' administered orally, noting their established mechanism of stimulating fibroblast activity and promoting extracellular matrix... 3 claims
Oral Intake of Chicken Bone Collagen Peptides Anti-Skin Aging in Mice by Regulating Collagen Degrada 2022 The document studies the anti-aging effects of a mixture of small collagen peptides (<3000 Da) derived from chicken bone, focusing on regulating the skin extracellular matrix (ECM) components like... 3 claims
PKCδ as a regulator for TGFβ1-induced α-SMA production in a murine nonalcoholic steatohepatitis mode 2013 · PLOS ONE The document investigates a peptide inhibitor (dV1-1, sequence C-SFNSYELGSL) conjugated to a carrier peptide (TAT) used in a murine model of Nonalcoholic Steatohepatitis (NASH), a tissue... 2 claims
Peptide-Based Functional Biomaterials for Soft-Tissue Repair 2019 · Frontiers in Bioengineering The document is a review focused on 'Peptide-Based Functional Biomaterials for Soft-Tissue Repair.' It explicitly mentions the need to mimic native ECM components like 'collagen and elastin' and... 3 claims
Peptides Emerging Candidates for the Prevention and Treatment of Skin Senescence A Review 2025 This is a review article on cosmetic and anti-aging peptides used for skin senescence, which involves maintaining elasticity and structure. The document explicitly mentions peptides that 'Promote... 3 claims
Peptides and Their Mechanisms of Action in the Skin 2024 · Skin. Appl. Sci. The document is an editorial review of bioactive peptides used in skin care. It explicitly names several modified peptides (e.g., Pal-KTTKS, Ac–Asp–Val–Lys–Tyr–OH) and reports their activity... 3 claims
Pharmacomodulation of Broad Spectrum Matrix Metalloproteinase Inhibitors Towards Regulation of Gelat The document focuses on Matrix Metalloproteinases (MMPs), specifically gelatinases (MMP-2 and MMP-9), which are classified as elastases responsible for degrading elastic tissues. Research into the... 3 claims
Phototherapy to Facilitate Wound Healing Following Pacemaker Infection A Promising Tool to Improve O The document discusses the mechanism of a phototherapy patch, which involves increasing levels of the peptide glycyl-L-histidyl-L-lysine (GHK). It explicitly states that this peptide is known to... 2 claims
Phytochemical and Potential Properties of Seaweeds and Their Recent Applications A Review. 2022 · Review. Mar. The document is a review focused on bioactive compounds and applications of seaweeds, explicitly mentioning their use in cosmeceuticals and for treating 'aging' and 'matrix metalloproteinase... 2 claims
Plant and Microalgae Derived Peptides Are Advantageously Employed as Bioactive Compounds in Cosmetic 2019 · Frontiers in Plant Science This review discusses bioactive peptides used in cosmetics, specifically providing details on several sequences (e.g., GHK, GEKG, KTTKS, RGD) and their modifications (copper complexation,... 2 claims
Potential Cosmetic Active Ingredients Derived from Marine By-Products 2022 · Products. Mar. The document is a review on marine-derived cosmetic active ingredients, specifically focusing on hydrolyzed collagen/peptides used for anti-wrinkle/anti-aging effects. Elastin stimulation is a key... 3 claims
Preventive and Therapeutic Interventions in Solar Elastosis and Photoaging A Comprehensive Systemati 2025 This systematic review analyzes preventive and therapeutic interventions for solar elastosis and photoaging, which are characterized by dysfunctional dermal elastic matrix. The review explicitly... 2 claims
Proceedings of the 35th European Peptide Symposium Journal of Peptide Science and the The document is the proceedings of the European Peptide Symposium, which covers the chemistry, biochemistry, biology, and pharmacology of peptides. It includes 'Articles' and numerous presentations... 3 claims
Proceedings of the XXXVII National Meeting of the Italian Society for the Study of Connective Tissue 1979 · Journal of Histochemistry was founded The document is the proceedings/abstract volume for the 'XXXVII MEETING OF THE ITALIAN SOCIETY FOR THE STUDY OF CONNECTIVE TISSUES (SISC 2017)'. Elastin is a crucial component of connective tissues... 2 claims
Proteolysis of fibrillin-2 microfibrils is essential for normal skeletal development. The document investigates the proteolysis of Fibrillin-1 and Fibrillin-2 microfibrils, which are essential components for elastic fiber assembly. The study explicitly identifies specific cleavage... 3 claims
Pulmonary Emphysema Current Understanding of Disease Pathogenesis and Therapeutic Approaches 2025 The document is a review covering the pathogenesis of pulmonary emphysema, which is characterized by the destruction of elastin. It explicitly discusses 'Exploratory Therapeutic Approaches' aimed at... 1 claim
RECENT ADVANCES IN ELASTIN-BASED BIOMATERIALS The document is a review focusing on elastin-derived peptides and elastin-like polypeptides (ELPs), discussing their structure (e.g., VPGXG repeats, GVGVP, GGVP, GVGVAP), physicochemical properties,... 2 claims
RNA Sequencing and Related Differential Gene Expression Analysis in a Mouse Model of Emphysema Induc The document explicitly reports the sequence (VGVAPG) of an elastin peptide, its concentration (100 µg/mL), and its observed biological activity (induction of emphysema/inflammation) in an animal... 2 claims
Recent Advances in Microneedling-Assisted Cosmetic Applications 2024 This is a review paper on cosmetic applications that explicitly mentions the use of peptides as cosmetic agents delivered via microneedling, and states that microneedling stimulates collagen and... 2 claims
Red-light induced aggregation of phytochrome 1 decorated e2 protein nanocage The document utilizes and characterizes an Elastin-Like Polypeptide (ELP80) sequence as part of a fusion protein (Cph1-ELP80-SpyCatcher). While the study focuses on affinity precipitation and... 3 claims
Regulation of Uterine Spiral Artery Remodeling a Review. 2020 The document explicitly identifies and reports the activity of the specific elastin-derived peptide (matrikine) sequence VGVAPG, stating that it increased trophoblast migratory capacity in vitro.... 2 claims
Research Progress in Skin Aging, Metabolism, and Related Products 2023 · Products. Int. This is a review article on skin aging, metabolism (specifically protein metabolism), and related products. The abstract and introduction explicitly mention that fibroblasts synthesize collagen and... 2 claims
Research Progress on Bioactive Factors against Skin Aging 2024 · Aging. Int. The document is a comprehensive review on bioactive factors, specifically including peptides (polypeptides), utilized for anti-skin aging. Research on anti-aging peptides frequently covers... 3 claims
Research Progress on New Functions of Animal and Plant Proteins 2024 This review discusses the biological activity of peptides derived from animal and plant proteins, specifically addressing anti-skin photoaging, which involves the extracellular matrix (ECM)... 1 claim
RiboScreen sup TM sup Technology Delivers a Ribosomal Target and a Small-Molecule Ligand for Ribosom 2024 · Elastin. Int. The document investigates boosting tropoelastin production (elastin-stimulating activity), providing quantitative results and cell culture context, which are key requirements of the research goal.... 3 claims
Revisited and innovative perspectives of oral ulcer from biological specificity to local treatment The document reviews the mechanisms of mucosa-inspired scarless healing, which necessitates detailed discussion of extracellular matrix (ECM) components, including elastin regulation, compared to... 1 claim
Role of peptide–cell surface interactions in cosmetic peptide application 2023 The document investigates specific cosmetic peptide sequences (GHK, RGD-GHK, sOtx2-GHK) for their anti-aging activity in skin models. The research goal requires identifying peptides with... 3 claims
Selected Medicinal Herbs and Functional Peptides for Protection against Photoaging of the Skin 2019 · Journal of Cosmetics The document is a mini-review summarizing functional peptides used for protection against photoaging. Since photoaging involves the destruction of dermal elastic fibers, it is highly probable that... 1 claim
Selenized Chickpea Sprouts Hydrolysates as a Potential Anti-Aging Ingredient. 2023 The document investigates anti-aging bioactive peptides derived from food sources and explicitly evaluates their inhibitory effects on elastase and collagenase. While it reports elastase inhibition... 3 claims
Skin irritation and potential antioxidant, anti-collagenase, and anti-elastase activities of edible 2021 The document investigates anti-elastase activity of protein-rich insect extracts, which is an adjacent domain to elastin-stimulating activity (elastogenesis). Although specific peptide sequences are... 2 claims
Skin manifestations in diabetes—what is new Frontiers in Medicine The document is a review on diabetic skin manifestations and current treatments, mentioning 'specialised bioactive dressings' and 'anti-fibrotic therapies.' Pathologies like diabetic thick skin and... 1 claim
Specific role of N-methyl-D-aspartate (NMDA) receptor in elastin-derived VGVAPG peptide-dependent ca 2019 The document explicitly tests the elastin-derived peptide VGVAPG (10 nM) and the control sequence VVGPGA (a required data point for model training, as per the research goal). It provides specific... 3 claims
Spent Yeast Waste Streams as a Sustainable Source of Bioactive Peptides for Skin Applications 2023 · Applications. Int. The document explicitly evaluates the capacity of various peptide fractions (separated by molecular weight/length criteria, e.g., >1 kDa) to modulate the production of elastin in human skin cells... 2 claims
State-of-the-Art of Eggshell Waste in Materials Science Recent Advances in Catalysis, Pharmaceutical 2021 · Frontiers in Bioengineering The document reviews the use of the proteinaceous Eggshell Membrane (ESM) in biomedical applications, reparative medicine, and tissue engineering. ESM contains specific proteins (e.g., high in... 2 claims
Structural and functional analysis of a homotrimeric collagen peptide. The research goal seeks peptide sequences tested for elastin-stimulating activity. This document investigates a synthesized homotrimeric collagen peptide (based on Glycine, Proline, and... 2 claims
Structural characterization and in vivo pro-tumor properties of a highly conserved matrikine The document investigates and provides structural and functional data for specific elastin-derived peptides (EDPs): AGVPGLGVG (AG-9) and VGVAPG (VG-6). The research goal explicitly requires capturing... 3 claims
Study on the Skincare Effects of Red Rice Fermented by i Aspergillus oryzae i In Vitro. 2024 The document investigates the anti-aging effects of a fermentation product (RRFA) which is stated to contain peptides (0.22 wt%). Crucially, it directly measures and quantifies the... 3 claims
Study on the Effect of Bee Venom and Its Main Component Melittin in Delaying Skin Aging in Mice. 2025 · Mice. Int. The document investigates the peptide Melittin (MLT) for its anti-aging effects, providing quantitative data (doses of 0.05 and 0.5 mg·kg⁻¹, increased collagen content, hydroxyproline levels, and... 3 claims
Synergistic Antibacterial Effect of Mucus Fraction from <i>Cornu aspersum< i> and Cirpof 2025 The document investigates a protein/peptide fraction from snail mucus for its wound-healing activity on normal human fibroblasts and keratinocytes. Although the primary focus is antibacterial... 3 claims
Synergistic effect of collagen peptide and elastin peptide derived from salmon on promoting hyaluron 2009 The document investigates a salmon-derived Elastin Peptide (EP, Mw 1,600) on human dermal fibroblasts (SF-TY), providing quantitative outcomes (hyaluronic acid production and cell proliferation) and... 2 claims
Synthetic and Natural Agents Targeting Advanced Glycation End-Products for Skin Anti-Aging A Compreh 2025 The document reviews anti-aging agents focused on mitigating Advanced Glycation End-products (AGEs), which cause cross-linking and degradation of dermal matrix proteins (including elastin).... 3 claims
TRPM7 RPSA Complex Regulates Pancreatic Cancer Cell Migration 2020 · Frontiers in Cell The document investigates the activity of specific elastin-derived peptide sequences (EDPs, elastokines), explicitly naming VG-6 and AG-9, and reports on their ability to stimulate cell migration (an... 2 claims
Terrestrial Microorganisms Cell Factories of Bioactive Molecules with Skin Protecting Applications. 2019 The document is a review on bioactive molecules from terrestrial microorganisms used for skin protecting and anti-aging applications, specifically referencing the cosmetic and cosmeceutical sector.... 2 claims
The Anti-Photoaging Activity of Peptides from i Pinctada martensii i Meat. 2022 · Meat. Mar. The document investigates the anti-photoaging activity of specific identified peptides (e.g., Phe-His, Ala-Leu, Met-Tyr, Ala-Gly-Phe, and Ile-Tyr-Pro) derived from Pinctada martensii. Critically, it... 3 claims
The Clinical Evidence-Based Paradigm of Topical Anti-Aging Skincare Formulations Enriched with Bio-A The document is a review focusing on a specific bioactive peptide, SA1-III (KP1), and explicitly provides its full sequence (Ac-Met-Gly-Lys-Val-Val-Asn-Pro-Thr-Gln-Lys-NH2) and modifications... 3 claims
The Combined Anti-Aging Effect of Hydrolyzed Collagen Oligopeptides and Exosomes Derived from Human 2024 The document investigates Hydrolyzed Collagen Oligopeptides (HCOPs) for anti-aging effects on Human Skin Fibroblasts (HSFs). This involves the restoration of the dermal extracellular matrix (ECM) and... 3 claims
The Effect of Anti-aging Peptides on Mechanical and Biological Properties of HaCaT Keratinocytes 2017 · Journal of Peptide Research and Therapeutics The document investigates the effects of 'anti-aging peptides,' specifically Acetyl Tetrapeptide-2 (P1) and Acetyl Hexapeptide-50 (P2). The text explicitly states that P1 is 'known as a stimulator of... 3 claims
The Effects of Crosslinking on the Rheology and Cellular Behavior of Polymer-Based 3D-Multilayered S 2021 The document, although focused on cartilage scaffolds, explicitly discusses and characterizes 'elastin-like recombinant polymers (ELRs),' which are inherently peptide-based materials designed around... 2 claims
The Effects of a Novel Series of KTTKS Analogues on Cytotoxicity and Proteolytic Activity 2019 The document investigates novel analogues of the cosmetic peptide KTTKS (palmitoyl pentapeptide-3), providing sequence and modification details (palmitoyl, acetyl, lipoyl). Although the study... 3 claims
The Efficacy and Safety of CollaSel Pro sup ® sup Hydrolyzed Collagen Peptide Supplementation withou 2024 · Clin. Med. The document investigates the effect of Hydrolyzed Collagen Peptides (HCPs) on skin elasticity and anti-aging properties in humans, providing quantitative results (mPa values for elasticity). The... 2 claims
The Elastin Receptor Complex A Unique Matricellular Receptor with High Anti-tumoral Potential 2016 · Frontiers in Pharmacology The document is centrally focused on bioactive elastin-derived peptides (elastokines) and their specific sequences (e.g., VGVAPG, GxxPG, YTTGKLPYGYGPGG). Although the context is cancer signaling... 3 claims
The Elastin Receptor Complex An Emerging Therapeutic Target Against Age-Related Vascular Diseases Frontiers in Endocrinology The document is a review focused on Elastin-Derived Peptides (EDPs, or elastokines), their consensus sequence (xGxxPG), and the Elastin Receptor Complex (ERC). It explicitly mentions 'current... 2 claims
The Functional Role of Extracellular Matrix Proteins in Cancer 2022 The document reviews the Extracellular Matrix (ECM) and its degradation fragments ('matrikines,' which include peptides derived from elastin). Although the primary domain is cancer, it is highly... 2 claims
The Innovative Biomaterials and Technologies for Developing Corneal Endothelium Tissue Engineering S 2023 The document is a review of biomaterials and bioactive materials for corneal endothelium tissue engineering scaffolds. While the focus is on corneal tissue, such reviews frequently detail specific... 2 claims
The Potential of Algae in the Nutricosmetic Sector. 2023 This is a review of algae metabolites (including peptides) used in the nutricosmetic and anti-aging sectors. Anti-aging/anti-wrinkling activities frequently involve the stimulation of dermal matrix... 1 claim
The Reparative Effect of <i>Dendrobium officinale< i> Protocorms against Photodamage Cau 2019 · Biol. Pharm. Bull. The study uses 'Matrixyl' (a recognized matrikine messenger peptide) as a positive control at a specific concentration (10 mg/mL) in an in vivo anti-photoaging assay. This setup provides highly... 2 claims
The Role of Macrophages in the Infarcted Myocardium Orchestrators of ECM Remodeling 2019 · Frontiers in Cardiovascular Medicine The document reviews Extracellular Matrix (ECM) remodeling, focusing on the roles of macrophages, fibroblasts, and regulating signals (like TGFβ1, MMPs) in post-infarction repair and fibrosis.... 3 claims
The Role of Lysyl Oxidase Enzymes in Cardiac Function and Remodeling 2019 This review details the crucial mechanism of elastin maturation (cross-linking) mediated by Lysyl Oxidase (LOX) enzymes, which is central to elastin function. It explicitly mentions the biological... 2 claims
The Role of Mitochondria-Derived Peptides in Cardiovascular Diseases and Their Potential as Therapeu 2021 · Targets. Int. The document reviews specific small peptides (Mitochondria-Derived Peptides: Humanin, MOTS-c, SHLPs) and explicitly mentions studying 'modified and synthetic MDPs' for their therapeutic application... 1 claim
The Skin Aging Process and Anti-Aging Strategies The document is a review of the skin aging process and anti-aging strategies, focusing on repairing skin damage through stimulation of collagen production at the cellular level. Since loss of... 1 claim
The Use of Proteins, Lipids, and Carbohydrates in the Management of Wounds. 2023 This is a comprehensive review on the use of proteins and biopolymers in wound healing, which involves the remodeling and production of the extracellular matrix (ECM), including elastin synthesis.... 2 claims
The VGVAPG Peptide Regulates the Production of Nitric Oxide Synthases and Reactive Oxygen Species in 2019 The document provides specific quantitative activity data (sequence: VGVAPG, cell type: mouse astrocytes, concentrations: 10 nM and 1 µM, outcomes: modulation of ROS/NO production) for a canonical... 3 claims
untitled The document's table of contents includes an article titled 'The Use of Fish Elastin Hydrolyzate to Enhance Fibroblast Proliferation, Elastin Synthesis in Them, and Improve Human Skin Condition.'... 3 claims
The cell-elastin-elastase(s) interacting triade directs elastolysis Frontiers in Bioscience The document reviews Elastin Peptides (EPs), referred to as 'potent matrikines' or 'elastokines' (Section 5). These peptides are the focus of the research goal, which seeks reported sequences tested... 3 claims
The distribution and function of elastin and elastic fibres in the canine cruciate ligament complex The document investigates the biological effects of elastin degradation products (EDPs) containing the specific peptide motif 'VGVAPG' on canine ACL cells in vitro, resulting in increased... 2 claims
The elastin peptide VGVAPG increases CD4+ T-cell IL-4 production in patients with chronic obstructiv 2021 The document identifies a specific elastin-derived peptide sequence (VGVAPG) and quantitatively characterizes its biological activity (modulation of IL-4 in CD4+ T-cells) mediated via the elastin... 2 claims
The modulation of dynamin and receptor endocytosis machinery using elastin-like polypeptides The document extensively utilizes and characterizes Elastin-Like Polypeptides (ELPs). Although the specific biological activity measured is receptor endocytosis and signaling, not native elastin... 3 claims
Therapeutic Potential of Annexin A1 Modulation in Kidney and Cardiovascular Disorders. 2021 The document, a review on Annexin A1, explicitly identifies and lists specific N-terminal derived peptides (Ac2-26, Ac2-12, and Ac2-6) that are acetylated (a required modification detail). These... 1 claim
Therapeutic Potential of Human Umbilical Cord-Derived Mesenchymal Stem Cells in Recovering From Muri 2021 · Frontiers in Medicine The study investigates tissue repair in emphysema and reports a specific quantitative outcome: hUC-MSCs conditioned medium increases messenger RNA expressions of elastin in lung fibroblasts. This... 2 claims
Therapeutic Potential of Neopyropia yezoensis An Updated Review 2025 · Review. Mar. This document is a review of the therapeutic potential of seaweed compounds, explicitly covering synthetic and recombinant peptides and their anti-aging activities. Elastin stimulation is a primary... 2 claims
Thrombospondin-1 Signaling Through the Calreticulin LDL Receptor Related Protein 1 Axis Functions an The document reviews Thrombospondin-1 (TSP-1), a major regulator of the extracellular matrix (ECM). It discusses specific functional domains/sequences (N-terminal domain) and their roles in... 3 claims
Tissue Regeneration A Silk Road. 2016 This is a review focused on silk fibroin (SF) proteins/peptides for various tissue regeneration applications, including skin, tendon, and ligament. SF structure is discussed (amino acid sequences,... 1 claim
Toll-like receptor 2 activation and serum amyloid A regulate smooth muscle cell extracellular matrix 2017 · PLOS ONE The document investigates the regulation of smooth muscle cell extracellular matrix, specifically focusing on insoluble elastin accumulation and tropoelastin expression (Eln mRNA). It tests defined,... 3 claims
Topically applied GHK as an anti-wrinkle peptide Advantages, problems and prospective This review explicitly focuses on the peptide GHK (Glycyl-histidyl-lysine) and its modified forms (GHK-Cu, Pal-GHK). The text specifically states that GHK is a signal peptide 'capable of promoting... 3 claims
Topisches Anti-Aging Prof. Dr. The document is a comprehensive review article on topical anti-aging in dermatology, a field that heavily utilizes peptides designed to stimulate dermal matrix components (like elastin and collagen).... 3 claims
Transmembrane Peptides as a New Strategy to Inhibit Neuraminidase-1 Activation 2020 · Frontiers in Cell The document investigates interfering peptides (IntPep) designed to inhibit Neuraminidase-1 (NEU1). NEU1 is explicitly stated to be a key component of the Elastin Receptor Complex (ERC) and 'required... 3 claims
Treatment of Skin Aging and Photoaging with Innovative Oral Dosage Forms of Non-Hydrolized Carnosine 2017 The document investigates the anti-aging effects of specific dipeptide sequences (Carnosine and Carcinine, including the non-hydrolyzed modification) on human skin fibroblasts. Although the abstract... 3 claims
Trending Anti-Aging Peptides 2020 The document is a review of anti-aging peptides used in cosmetics, explicitly categorizing 'Signal peptides' as those that 'stimulate matrix protein production (such as collagen and elastin)'. It... 3 claims
Trends in the Development of Tailored Elastin-Like Recombinamer–Based Porous Biomaterials for Soft a This document is a review focusing on Elastin-Like Polypeptides (ELPs) and Elastin-Like Recombinamers (ELRs). ELRs are defined, customized peptide sequences (and their modifications) whose... 3 claims
Tropoelastin inhibits vascular calcification via 67-kDa elastin binding protein in cultured bovine a Journal of Atherosclerosis and Thrombosis The document explicitly tests the biological activity of a specific elastin-derived peptide sequence, VGVAPG. It provides the concentration range (0.1–1000 nM), the cell type (BASMCs), the assay... 3 claims
Tropoelastin and Elastin Assembly 2021 · Frontiers in Bioengineering This review focuses on tropoelastin structure and assembly. It explicitly discusses the use of synthetic peptides derived from tropoelastin's hydrophobic (e.g., VPGVG) and cross-linking domains,... 2 claims
Tumor Microenvironment Extracellular Matrix Alterations Influence Tumor Progression 2020 · Frontiers in Oncology This mini-review focuses on Extracellular Matrix (ECM) degradation and the role of ECM fragments, known as matrikines or matricryptins. These fragments include elastin-derived peptides, which are... 2 claims
Tumour cell blebbing and extracellular vesicle shedding key role of matrikines and ribosomal protein 2019 · Journal of Cancer The document investigates specific elastin degradation products (EDPs) – VGVAPG and AGVPGLGVG – and reports their quantitative biological outcomes (inducing cell blebbing, affecting calcium influx)... 3 claims
Turning a Collagenesis-Inducing Peptide Into a Potent Antibacterial and Antibiofilm Agent Against Mu 2019 · Frontiers in Microbiology The document investigates synthetic peptides (KTTKS and derivatives, including palmitoylation) known as matrikines for their 'collagenesis-inducing' behavior in human fibroblasts (HFF-1). While the... 3 claims
Uncoupling of Elastin Complex Receptor during In Vitro Aging Is Related to Modifications in Its Intr 2015 · PLOS ONE The document investigates the biological activity and signaling pathways triggered by specific elastin-derived peptides (EDP), which are known stimulators of matrix synthesis/elastogenesis. It... 3 claims
Unlocking the Health Potential of Microalgae as Sustainable Sources of Bioactive Compounds 2021 · Compounds. Int. The document is a comprehensive review on bioactive compounds from microalgae for human health applications. Although the provided excerpt focuses on pigments (fucoxanthin) and internal health... 2 claims
Unraveling Elastic Fiber-Derived Signaling in Arterial Aging and Related Arterial Diseases 2025 This review focuses specifically on 'elastin-derived peptides' (EDPs) and their signaling role (via the elastin receptor complex, ERC) in arterial aging and disease. Although the documented activity... 3 claims
Use of Collagen in Cosmetic Products. 2024 · Products. Curr. This is a review on the use of collagen peptides (hydrolysates) in cosmetics to improve skin elasticity. While the specific elastin-stimulating sequences and quantitative outcomes are not detailed in... 2 claims
Usage of Synthetic Peptides in Cosmetics for Sensitive Skin. 2021 The document is a review focusing on synthetic peptides used in cosmetics, specifically listing sequences (e.g., acetyl dipeptide-1 cetyl ester, palmitoyl tripeptide-5, palmitoyl tetrapeptide-7)... 3 claims
Use of Waste from the Food Industry and Applications of the Fermentation Process to Create Sustainab 2024 This is a review focused on sustainable cosmetic ingredients, often derived through fermentation of food waste. The resulting bioactive materials frequently include peptides (hydrolysates) that are... 1 claim
Vascular elastic laminae anti-inflammatory properties and potential applications to arterial reconst Frontiers in Bioscience The document reviews the composition and structure of arterial elastic laminae (elastin), explicitly listing core peptide repeat sequences (e.g., GVGVP, GGVP, GVGVAP) and a sequence bound by the... 3 claims
Why Venous Leg Ulcers Have Difficulty Healing Overview on Pathophysiology, Clinical Consequences, an 2020 · Clin. Med. The document reviews the pathophysiology and treatment of Venous Leg Ulcers (VLU), a condition characterized by chronic inflammation and breakdown of the Extracellular Matrix (ECM). The text mentions... 3 claims
Wrinkle Reduction Using Tetrapeptide-68 Contained in an O W Formulation A Randomized Double-Blind Pl 2024 The document identifies a specific tetrapeptide (Tetrapeptide-68, sequence GQVS) that was selected for its 'elastase inhibitory activity' and 'skin cell proliferating–promoting ability.' While the... 3 claims
Wrinkle-Improving Effect of Novel Peptide That Binds to Nicotinic Acetylcholine Receptor 2024 · Receptor. Int. The document reports the sequence (RRGVRR) and detailed quantitative outcomes of a peptide aimed at reducing wrinkles and enhancing skin elasticity. While the primary measured matrix protein is... 3 claims
untitled The review covers biomimetic peptides used in dermatology/anti-aging. It explicitly identifies 'Signal peptides' that trigger increased expression of elastin (along with collagen and proteoglycans).... 3 claims
[A turning point in the knowledge of the structure-function-activity relations of elastin]. 2001 This document is a review dedicated to analyzing the structure-function-activity relationship of elastin and specific elastin-derived peptides (elastokines), including VGVAPG, PGAIPG, and related... 2 claims
Zur Pathogenese des Marfan-Syndroms Untersuchung der Matrix- Metalloproteinase-Regulierung nach Stim 2005 · Journal of Molecular and Cellular Cardiology The document investigates recombinant Fibrillin-1 peptide fragments containing the Glycin-x-x-Prolin-Glycin (GxxPG) consensus sequence, which is the binding motif for Elastin-Binding Protein (EBP).... 2 claims
untitled The document is a review of cosmeceutical peptides and contains a dedicated section on 'Elastin modulating peptides.' It explicitly identifies Palmitoyl-pentapeptide (Pal-KTTKS) as stimulating... 3 claims

Document	Claims
acceptée sur proposition du jury: Prof. V. Hatzimanikatis, président du jury Prof. J. A. Hubbell, directeur de thèse Prof. T. Barker, rapporteur 2009 · Cole Polytechnique F D Rale De Lausanne Epfl The document investigates engineered peptide/protein delivery (IGF1 fused with a Factor XIIIa substrate sequence, derived from alpha2-plasmin inhibitor) to stimulate smooth muscle cell growth and... 3 claims
Arteriosclerosis, Thrombosis, and Vascular Biology Arterioscler Thromb Vasc Biol. 2025;45:00–00. DOI: 10.1161/ATVBAHA.124.322350 2025 · University Of Cambridge The document investigates the protective role of a specific peptide (C-type Natriuretic Peptide, CNP) against aortic aneurysm progression. A key outcome measured is the reduction of 'elastin... 3 claims
Relaxin receptor deficiency promotes vascular inflammation and impairs outward remodeling in arteriovenous fistulas Utrecht University The document investigates the role of Relaxin (RLN), a 6-kDa peptide hormone, and its receptor (RXFP1) on vascular remodeling, providing explicit quantitative data on elastin content (43% increase)... 3 claims

Document	Claims
US-10004779-B2 2018 The document identifies a specific peptide sequence (Val-Gly-Val-Ala-Pro-Gly, SEQ ID NO: 19) used in conjunction with other agents for its role related to elastic fibers. Furthermore, the description... 3 claims
US-10081667-B2 2018 The document provides specific peptide sequences (Elastin-Like Polypeptides, VPGXG repeats, various lengths/ratios, SEQ ID NOs 2-13) that are fundamental components/mimics of elastin. Although the... 3 claims
US-10137156-B2 2018 The document reports specific sequences of Elastin-Like Polypeptides (ELPs) based on the VGVPG motif (e.g., [VGRGD(VGVPG)6]n, SEQ ID NO: 4) and provides quantitative data regarding their structure,... 3 claims
US-10167325-B2 2019 The patent claims and describes specific peptide sequences (e.g., IGVAPG, VGAMPG) and modifications (N-terminus acetylation) that are asserted to stimulate elastogenesis and act as ligands for... 3 claims
US-10239902-B2 2019 The document provides specific peptide sequences (e.g., KVK, RGD) of relevant lengths (2-5 residues) and details required modifications (palmitoylation, stearylation, conjugation to ascorbic acid).... 3 claims
US-10258556-B2 2019 The document discloses a specific peptide sequence (ProAspSerThrGluAlaLys, SEQ ID NO: 1) and provides experimental evidence (FIG. 1 and description) showing its effect on enhancing elastin (ELN) mRNA... 2 claims
US-10272059-B2 2019 The document claims specific ratios of free amino acids (Glycine, L-proline, L-alanine, L-valine, L-leucine, L-lysine) that are the fundamental building blocks of known elastin-stimulating peptides.... 3 claims
US-10434340-B2 2019 The document, a patent, directly discusses and claims the use of 'palmitoyl tetrapeptide 7' for treating skin conditions associated with aging, such as 'loss of elasticity' and 'fine lines and... 2 claims
US-10463592-B2 2019 The document provides specific short peptide sequences and modifications (acetylation, amidation) designed for dermal anti-aging effects, focusing on promoting fibroblast growth, hyaluronic acid... 3 claims
US-10478461-B2 2019 The document is a patent describing the use of cellular extracts containing polypeptides/proteins for improving skin health, cosmetic appearance, anti-aging, and wound healing. These therapeutic... 2 claims
US-10596095-B2 2020 The document identifies a specific peptide (P-113/SEQ ID NO: 1) used for anti-aging and improving skin elasticity, a highly related domain to elastin stimulation. It provides quantitative findings... 3 claims
US-10588844-B2 2020 The document introduces a specific modified peptide sequence (Oleanoyl-KVK) and claims anti-elastase activity. While the research goal focuses on elastin-stimulating activity, anti-elastase activity... 2 claims
US-10596230-B2 2020 The document defines specific Elastin-Like Peptide (ELP) sequences (VPGXG repeats, V:A:G ratio, and precise lengths like 90, 120, or 144 units). Although the patent focuses on using these ELPs for... 3 claims
US-10610479-B2 2020 The document explicitly identifies a specific modified peptide, palmitoyl tripeptide 38, and claims its function is to enhance elastin, directly addressing the core requirement of finding reported... 3 claims
US-10668000-B2 2020 This patent describes specific peptide formulas (X-Pro-Pro-Xaa-Y, like Myr-PPL-OH and Myr-PPR-OH) and explicitly claims their use to 'stimulate the synthesis of... elastin.' It provides the required... 3 claims
US-10688156-B2 2020 The document describes a therapeutic agent incorporating a specific Elastin-Like Peptide (ELP) sequence (VPGXG repeat units, SEQ ID NO: 3). It provides quantitative outcomes (dosing 1-10 mg/kg/day,... 3 claims
US-10822382-B2 2020 The document discloses specific polypeptide sequences (HSP90a, HPf, HPfΔC1, HPfΔC2) intended for topical use to improve skin conditions, specifically mentioning 'skin elasticity' and 'wrinkles.'... 2 claims
US-10844101-B2 2020 This patent directly describes and claims novel synthetic peptides (e.g., VGLMPG, IGLMPG) and modifications (N-acetylation, metal complexation) explicitly designed to serve as ligands for elastin... 3 claims
US-10869948-B2 2020 The document is a patent describing an 'elastin peptide' composition resulting from enzymatic hydrolysis, which is explicitly claimed to 'significantly increase the amount of the elastin' in damaged... 3 claims
US-10905734-B2 2021 The document describes numerous specific peptide sequences (SEQ ID NOs 15-775) derived from pea and rice proteins and explicitly states that these peptides have been shown to have an effect on... 3 claims
US-10925922-B2 2021 The document, a patent describing cosmetic/therapeutic peptides derived from plant proteins, explicitly states that the identified peptides 'have been shown to have an effect on elastin and collagen... 3 claims
US-10934343-B2 2021 The patent provides specific, designed tropoelastin-derived polypeptide sequences (Elastin-like Polypeptides, including SEQ ID NO: 8) and defined repeating units/modifications (e.g., Cysteine... 3 claims
US-10961317-B2 2021 The document explicitly discloses specific, long Elastin-Like Peptide (ELP) sequences (e.g., G(VPGAG)192Y) and their modifications (fusion to scFv). While the disclosed function is anti-cancer... 3 claims
US-10961523-B2 2021 The document lists specific, modified peptide sequences (Cu-GHK tripeptide, palmitoyl-KTTKS pentapeptide, palmitoyl-GHK, palmitoyl-GQPR) that are prototypical agents studied and used for stimulating... 2 claims
US-11001607-B2 2021 The document, a patent, explicitly claims and describes novel peptides (e.g., Pal-K(Ac)GH) that are active in stimulating the synthesis of elastin, which directly addresses the research goal of... 3 claims
US-11007385-B2 2021 The patent directly addresses the research goal by focusing on methods and compositions (fish egg cellular extracts) for 'stimulating elastin production' in skin cells (fibroblasts). While the active... 1 claim
US-11084867-B2 2021 The document explicitly discusses the use of 'tropoelastin or elastin derived peptide' for tissue healing. While the provided abstract and claims focus on the delivery system and the full protein,... 3 claims
US-11103558-B2 2021 The document explicitly defines specific sequences and lengths of Elastin-Like Peptides (ELPs), such as VPGXG repeating units (90, 120, 144 times) used in fusion proteins. While the primary activity... 3 claims
US-11123578-B2 2021 The document identifies a specific modified peptide, Palmitoyl tetrapeptide-7, and claims its use in compositions that increase skin elasticity and firming. Increased elasticity is directly linked to... 3 claims
US-11149262-B2 2021 The document describes defined polypeptide sequences (Botulinum toxin binding domains and fragments, e.g., Hc/A, Hcn/A) and reports their activity in modulating gene expression in primary human... 3 claims
US-11155579-B2 2021 The patent directly claims that the described peptides (e.g., SEQ ID NOs: 2-15) have advantageous effects in 'increasing production of... elastin.' Identifying these sequences and their claimed... 3 claims
US-11306121-B2 2022 The document introduces a specific peptide sequence (SEQ ID NO: 1) tested for anti-wrinkle cosmetic applications. While the abstract focuses on muscle relaxation and collagen stimulation (Claim 10),... 3 claims
US-11471395-B2 2022 The document is a patent detailing specific peptide sequences (SEQ ID NOs 1-6) derived from fish skin and providing quantitative evidence of their activity on human cells. Although the primary... 3 claims
US-11523982-B2 2022 The document claims that compositions containing marine extracts stimulate the production of elastin (elastin-stimulating activity). While it does not identify specific peptide sequences or detailed... 3 claims
US-11571378-B2 2023 The document identifies specific modified peptide sequences (palmitoyl dipeptide-7, acetyl tetrapeptide-11) along with concentrations, targeting 'extracellular matrix repair and renewal processes.'... 3 claims
US-11596813-B2 2023 The document explicitly identifies a modified peptide, palmitoyl tetrapeptide 7, and claims its use for improving skin elasticity and firmness. This directly addresses the research goal of... 3 claims
US-11607445-B2 2023 The document describes and lists specific sequences (SEQ ID NOs 1-9) of Elastin-Like Polypeptides (ELPs) and their modified conjugates (C-peptide bound to ELP, K8, K9-C-peptide). Although the primary... 3 claims
US-11612556-B2 2023 The document, a patent, explicitly defines and claims novel modified peptide sequences (e.g., Pal-K(P)-HG-OH, including palmitoylation and side-chain modification) that are designed and stated to... 3 claims
US-11628133-B2 2023 The document provides a specific peptide sequence (His-D-Trp-Ala-Trp-D-Phe-Lys-NH2), its modifications (D-amino acids, C-terminal amide), concentration (0.1-1 μM), cell type (fibroblasts), and... 3 claims
US-11679284-B2 2023 The document, a patent application concerning cosmetic compositions, explicitly discloses the use of a specific modified peptide sequence (palmitoyl tetrapeptide-7) in formulations intended to... 3 claims
US-11707500-B2 2023 The document is a patent describing specific peptide sequences (SEQ ID NOs provided) that are used for the prevention of human skin aging. The description explicitly states that these peptides have... 3 claims
US-11739126-B2 2023 The document provides specific peptide sequences and defined lengths for Elastin-Like Polypeptides (ELPs), which are highly relevant structural derivatives of elastin (e.g., (GVGVP)n). Although the... 3 claims
US-11746125-B2 2023 The patent explicitly claims that the described peptides (e.g., RPIK, PRPIK, and others listed as SEQ ID NOs 2-15) are used for 'increasing production of elastin' (elastin-stimulating activity). This... 3 claims
US-11850299-B2 2023 This patent provides specific modified peptide sequences (palmitoyl dipeptide-7, acetyl tetrapeptide-11) and their modifications, lengths, and tested concentrations, all critical components required... 3 claims
US-11951203-B2 2024 The document provides specific peptide sequences (acetyl hexapeptides, Lys-Pro) and modifications (acetylation, complexation) intended for use in skin anti-aging/wrinkle reduction. This biological... 3 claims
US-12064494-B2 2024 The document identifies a specific, chemically modified oligopeptide, 'palmitoyl sh-tripeptide-4 amide,' used in anti-aging and aesthetic skin formulations (0.0001%-10% w/w). Although the abstract... 3 claims
US-12161745-B2 2024 The document discloses specific modified peptide sequences (e.g., Pal-His-Tyr-Arg-Ala-NH2) intended for anti-aging applications, specifically resulting in 'skin firming' and reducing 'sagginess.'... 3 claims
US-12186420-B2 2025 The document describes a specific peptide sequence (QHREDGS) used in cosmetic compositions aimed at improving skin appearance. Crucially, Claim 1 explicitly states that the improvement includes... 3 claims
US-12214009-B2 2025 The patent explicitly claims compositions and methods for 'stimulating elastin and/or collagen production' using specific peptides (tripeptide-1, hexapeptide-11, hexapeptide-12, hexapeptide-38,... 3 claims
US-12286461-B2 2025 The document provides specific peptide sequences (X, Y, and fused polypeptides) and structural modifications (Acetylation) intended to treat skin and tissue fibrosis by regulating the Extracellular... 3 claims
US-12371705-B2 2025 The document defines a specific partial human elastin peptide sequence (SEQ ID NO: 25) intended for use in skin care compositions. It reports in vitro testing results (non-cytotoxicity, upregulation... 3 claims
US-12391912-B2 2025 The document explicitly discloses sequences (SEQ ID NOs 1-3) for 'elastin-like peptides (ELPs)' and related disordered polypeptides, fulfilling the requirement to capture peptide sequences related to... 3 claims
US-12421277-B2 2025 The document discloses a specific peptide sequence (YLP) and quantitative claims regarding its anti-aging activity (increasing collagen and hyaluronic acid levels) on skin cells. Although... 2 claims
US-2002082196-A1 2002 The document lists several novel peptide sequences (SEQ ID NO: 4-8) with specified modifications (N-terminal acetylation) that are claimed to have 'wound healing activity.' Since elastin synthesis is... 3 claims
US-2002165185-A1 2002 The patent discloses novel HICP polypeptides (e.g., SEQ ID NO:2) and explicitly claims that these proteins/peptides can modulate 'extracellular matrix production' (Claim 29, part vi). Elastin is a... 3 claims
US-2003007938-A1 2003 The document describes the composition and use of ionic metal-peptide complexes derived from elastin hydrolysates (elastin peptides) complexed with Copper (II) for stimulating growth and repair. This... 2 claims
US-2003166510-A1 2003 The patent directly addresses the mechanism of interest (accelerating skin remodeling by enhancing the skin's production of collagen and elastin, paragraph [0004]). It specifies the use of short,... 3 claims
US-2004002449-A1 2004 The document provides specific peptide sequences (METH1, METH2, and various TSP domains/homologs, identified by SEQ ID NOs) derived from the thrombospondin (TSP) family, which are key components and... 2 claims
US-2004120918-A1 2004 The document explicitly claims cosmetic compositions containing the peptide sequence Val-Gly-Val-Ala-Pro-Gly (VGVAPG, SEQ ID NO: 1) and N-acyl derivatives thereof (specifically N-palmitoyl-VGVAPG,... 2 claims
US-2004141939-A1 2004 The document proposes specific peptide sequences (e.g., Lys-Leu-Asp-Ala-Pro-Thr) and their derivatives for use in compositions designed to reinforce the extracellular matrix. It explicitly claims... 3 claims
US-2004162232-A1 2004 The patent claims compositions containing specific peptide sequences derived from elastin (e.g., GXXPG, PGGVLPG, VGVVPG, IGLGPGGV) that are explicitly used to stimulate the endogenous production and... 3 claims
US-2004258676-A1 2004 The document defines comprehensive screening methods, cell models (fibroblasts, keratinocytes), and molecular targets (LOX, Tropoelastin) specifically aimed at identifying active principles that... 3 claims
US-2005054578-A1 2005 The document, specifically the Abstract, Claims (e.g., Claim 23 mentioning 'increased mRNA levels in skin cells' and 'increased elasticity'), and the Description (referencing FIG. 1 showing... 3 claims
US-2005059599-A1 2005 The document, a patent, directly claims the use of numerous specific peptide sequences (listed as SEQ ID 1 through SEQ ID 41) for 'enhancing tissue elasticity' and explicitly claims 'stimulating... 3 claims
US-2005124545-A1 2005 The document discloses specific peptide sequences (e.g., Arg-Asp-Phe-Thr-Lys-Ala-Thr-Asn-Ile-Arg-Leu-Arg-Phe-Leu-Arg) intended to increase the expression of extracellular matrix (ECM) proteins to... 3 claims
US-2005239710-A1 2005 The document details peptide sequences intended to inhibit matrix metalloproteinases (MMPs) for applications like discouraging wrinkling and encouraging healthy skin. Since MMPs, including MMP-2, are... 3 claims
US-2006013794-A1 2006 The document identifies specific peptide sequences (Arg-Gly-Ser and variants), relevant modifications (acetylation/acylation), and concentration ranges intended for use in stimulating extracellular... 1 claim
US-2006045894-A1 2006 The document explicitly identifies a modified peptide, 'palmitoyl pentapeptide-3,' and claims its activity is to 'stimulate production of collagen and elastin in skin.' This directly provides a... 1 claim
US-2006264375-A1 2006 The document explicitly discusses the use of elastin-derived peptides (specifically naming ProK60 and E91) as stimulators of elastogenesis. It confirms that these peptides are known to stimulate the... 3 claims
US-2007003536-A1 2007 The document explicitly states that the compositions 'promote synthesis of collagen and elastin.' The claims include protein/peptide sources (superoxide dismutase, glutathione, soybean protein,... 2 claims
US-2007031367-A1 2007 The document explicitly identifies specific modified peptides—palmitoyl pentapeptide-3 and palmitoyl tetrapeptide-3—that are claimed to stimulate the production of elastin in skin. This directly... 2 claims
US-2007086966-A1 2007 The document identifies a specific, modified peptide sequence (palmitoyl-gly-his-lys) used in an anti-aging/rejuvenating cosmetic context, which is highly relevant to research on elastin-stimulating... 2 claims
US-2007166267-A1 2007 The document provides specific short chain peptide sequences (e.g., Phe-Ala-Leu-Leu-Lys-Leu) and required modifications (palmitoylation/acylation, acetylation) at defined concentrations (0.001% to... 3 claims
US-2007218003-A1 2007 The document provides specific polypeptide sequences (via SEQ ID NOs) derived from DANCE, which are claimed to be regulators of elastic fiber formation (e.g., having lysyl oxidase-binding activity or... 2 claims
US-2007237735-A1 2007 The patent claims peptides (oligopeptides of 20 AA or less, including Pal-VGVAPG) that correspond to fragments of extracellular matrix proteins, specifically naming 'elastin' and 'tropoelastin'... 2 claims
US-2007286885-A1 2007 The document explicitly identifies and claims a specific elastin pentapeptide sequence (VGVPG) and details its modifications (incorporation into various block copolymers and conjugates). Although... 3 claims
US-2008050459-A1 2008 The document explicitly identifies and claims the use of Oligopeptide-5 as a 'pro-Elastin oligopeptide.' Although it lacks specific quantitative in vitro assay data (sequence, cell type, % increase),... 3 claims
US-2008050346-A1 2008 The document, a patent, directly addresses the research goal by claiming and listing numerous specific synthetic peptide sequences (SEQ ID NOs 2, 47-49, 51-56, 58-63) that are defined as 'elastogenic... 3 claims
US-2008058261-A1 2008 The document identifies specific short peptide sequences (including modifications like retro-inverso and reduced peptide bonds) derived from tropoelastin. While the reported activity is protease... 3 claims
US-2008081034-A1 2008 The document explicitly targets the promotion of elastin synthesis and the inhibition of elastase, which directly aligns with the research goal of finding elastin-stimulating activity. Although... 3 claims
US-2008081082-A1 2008 The document, a patent application for topical compositions, explicitly claims to 'promote synthesis of collagen and elastin.' While the listed components are primarily complex protein sources... 1 claim
US-2008161229-A1 2008 The patent identifies oligopeptides (derived from nucleoprotein/DNA hydrolysis, fractions 1000-3000 Da) as active ingredients in cosmetics targeting cellular stimulation and anti-wrinkle effects.... 1 claim
US-2008181974-A1 2008 The document names specific, modified peptides (e.g., acetyl hexapeptide 3, palmitoyl oligopeptide pentapeptide 3, palmitoyl tetrapeptide 7) which are identified as active agents intended to improve... 3 claims
US-2008194476-A1 2008 The patent claims the avocado peptide extract functions as a 'specific elastase inhibitor' (Claim 30). Although it provides composition rather than specific individual sequences, elastase inhibition... 2 claims
US-2008227725-A1 2008 The document identifies specific peptide sequences ((AA)n-Arg-Gly-Ser-(AA)n, including Arg-Gly-Ser when N=0) and modifications (acetylation, amidation) claimed for anti-aging effects. The described... 3 claims
US-2008260869-A1 2008 The document explicitly names specific modified peptides, including 'dipeptide valyl-tryptophane' (VW) and 'palmitoyl tetrapeptide-3' (Pal-Gly-Gln-Pro-Arg), and claims that the composition containing... 3 claims
US-2008292651-A1 2008 This patent discloses specific modified peptides ('palmitoyl wheat protein hydrolysate,' 'tripeptide' identified as glutathione or dipeptide diaminocutyroyl benzylamide diacetate) used in... 3 claims
US-2008306001-A1 2008 The patent explicitly claims novel peptides (referenced by SEQ ID NOs) and compositions designed to stimulate the synthesis of structural components of the extracellular matrix, specifically... 3 claims
US-2009012002-A1 2009 The document is a patent describing novel peptides and their modifications (acetylation, amidation) for use in treating cutaneous aging. Since anti-aging therapies often target the stimulation of... 3 claims
US-2009054346-A1 2009 The document is a patent specifically claiming and describing the peptide sequence Leu-Glu-His-Ala (LEHA) as an elastin production-enhancing agent. This directly addresses the research goal of... 3 claims
US-2009068219-A1 2009 This patent identifies specific oligopeptides (Human Oligopeptide-9, Oligopeptide-4, Oligopeptide-5) used in anti-aging applications. The description explicitly mentions the role of these... 2 claims
US-2009082280-A1 2009 The document is a patent claiming novel synthetic peptide sequences (VGAMPG, VGLSPG, etc., and linked dimers) that are specifically designed and claimed to stimulate elastogenesis... 3 claims
US-2009099098-A1 2009 The document identifies a specific peptide sequence (H-Lys-Glu-Asp-OH) that enhances vascular wall durability and capillaries resistance, using vascular wall explants for study. Since elastin is... 1 claim
US-2009136595-A1 2009 The document details specific acylated oligopeptide sequences (e.g., Palmitoyl hexapeptide-6: Phe-Ala-Leu-Leu-Lys-Leu) and their concentration ranges, intended for stimulating 'dermal fibroblast... 3 claims
US-2009137458-A1 2009 The document describes methods utilizing ionic metal-peptide complexes (addressing the 'metal complexation' modification) to accelerate skin remodeling, explicitly stating that this mechanism... 3 claims
US-2009137783-A1 2009 The document defines novel polypeptides (SEQ ID NOs provided implicitly) and lists diseases/conditions relevant to extracellular matrix remodeling, such as wound healing, scar formation, and... 3 claims
US-2009170182-A1 2009 The document describes a polypeptide (Lopap) and its functional derivatives (including various chemical modifications like acetylation and myristoylation) used as an anti-aging agent. Critically, the... 3 claims
US-2009186826-A1 2009 The document explicitly describes and claims the use of the peptide Palmitoyl-Val-Gly-Val-Ala-Pro-Gly (SEQ ID NO: 1), a well-known elastin mimetic peptide (VGVAPG), for treating signs of aging,... 3 claims
US-2009281044-A1 2009 The document, a patent, directly addresses the research goal by defining specific elastin peptide sequences (PGGVLPG, VGVVPG, IGLGPGGV, and the GXXPG motif) derived from an elastin digest. It... 3 claims
US-2010016417-A1 2010 The document explicitly names specific elastin-derived peptides, ProK60 and E91, which are characterized as 'stimulators of elastogenesis.' It also mentions the cell types used (primary cultures of... 2 claims
US-2010022455-A1 2010 The document defines and uses specific Elastin-Like Peptide (ELP) sequences (e.g., VPGXG repeats, SEQ ID NO: 3, and SEQ ID NO: 22) as components of therapeutic agents. While the primary function... 3 claims
US-2010034758-A1 2010 The document explicitly describes novel modified peptide sequences (Lys-Thr-Thr-Lys-Ser core sequence linked to various triterpenoid acids like Oleanolic acid or Ursolic acid) intended for... 3 claims
US-2010040710-A1 2010 The document directly addresses the stimulation and formation of elastic fibers (elastogenesis) by targeting lysyl oxidase-like (LOXL) activity and elastin expression, which is central to the... 3 claims
US-2010136103-A1 2010 The document details specific peptide sequences and their modifications used in anti-aging compositions targeting dermal extracellular matrix (ECM) components, specifically claiming stimulation of... 2 claims
US-2010145255-A1 2010 The document identifies a modified peptide ('acetyl hexapeptide') used specifically for skin rejuvenation and wrinkle reduction. Although the exact sequence and quantitative elastin data are not... 3 claims
US-2010184637-A1 2010 The document discloses specific peptide sequences (SEQ ID No. 1, 2) along with relevant modifications (amidation, acetylation) and concentrations, intended for anti-aging and dermatological use. The... 2 claims
US-2010215657-A1 2010 The patent provides specific amino acid sequences (SEQ ID NOs) of large polypeptides/fusion proteins intended for therapeutic use in age-related conditions, including 'wrinkles' and 'skin atrophy.'... 3 claims
US-2010247454-A1 2010 The document describes methods and compositions for stimulating elastogenesis in relevant cell types (human dermal fibroblasts, SMCs). While the primary active agents are mineral complexes, the... 3 claims
US-2010310484-A1 2010 The document provides numerous detailed peptide sequences (SEQ ID NOs 3-13) and complex modifications (lipoyl, potential palmitoyl, acetyl, hexyl, decyl) intended for treating aging-related skin... 3 claims
US-2010311668-A1 2010 The document introduces specific tetrapeptide sequences (GEPG, GPPG, PGPP, PKEK) and their N-acyl derivatives for use as anti-aging actives, targeting conditions like wrinkles and sagging skin. While... 3 claims
US-2011039776-A1 2011 The document defines specific sequences and modifications of Elastin-Like Peptides (ELPs), primarily based on VPGXG repeats (Claims 25-32). While the reported quantitative outcomes relate to drug... 3 claims
US-2011052517-A1 2011 The patent claims topical application of a metal-complexed peptide (SEQ ID NO:1) derived from yeast extracts for various anti-aging benefits, including 'increase in and/or preventing loss of skin... 3 claims
US-2011064832-A1 2011 The document explicitly identifies a specific modified peptide sequence, palmitoyl tetrapeptide-7, which is claimed to treat skin aging, firm skin, and reduce wrinkles. These activities are strongly... 3 claims
US-2011081322-A1 2011 The document, a patent application, explicitly identifies and lists numerous synthetic peptide sequences (e.g., SEQ ID NOs 47, 48, 49, 51, 58) that are claimed to act as 'elastogenic agents' and... 2 claims
US-2011086060-A1 2011 The document explicitly identifies specific, modified peptide sequences (e.g., N2-(1-oxohexadecyl)-L-lysyl-L-valyl-L-lysine and Palmitoyl-Lys-Thr-Thr-Lys-Ser) and attributes elastin-stimulating... 3 claims
US-2011091398-A1 2011 The document describes a novel composition comprising a specific peptide (SEQ ID No. 1) linked to a modification (oleanolic acid) used for treating skin aging. The stated mechanism of action... 3 claims
US-2011092422-A1 2011 The document defines specific Elastin-Like Peptide (ELP) sequences (e.g., (VPGXG) 47-101 and variants) which are directly relevant to the structure of elastin-related peptides. While the document... 3 claims
US-2011092431-A1 2011 The document provides explicit peptide sequences (e.g., Pro-Val-Val-Val-Pro-Pro) developed for skin aging and collagen production promotion. Although the activity claimed is collagen, this target... 3 claims
US-2011172400-A1 2011 The document describes isolated antibody single variable domain polypeptides (sequences/CDRs) and their activity. While the primary goal is CD40L antagonism, the description explicitly details how... 3 claims
US-2011237516-A1 2011 The patent directly identifies multiple novel peptide sequences (e.g., VGAMPG, IGLSPG, VGLSPG) and related linked peptides, and explicitly claims their utility and activity in stimulating... 3 claims
US-2011268812-A1 2011 The document lists numerous specific peptide sequences (including known elastin fragments like VGVAPG) and chemical modifications (e.g., palmitoylation) used in cosmetic compositions aimed at slowing... 3 claims
US-2012015064-A1 2012 The document explicitly identifies a specific modified peptide, 'palmitoyl tetrapeptide-7,' and its use in topical compositions for skin firming and reducing wrinkles (anti-aging). This directly... 2 claims
US-2012046640-A1 2012 The document identifies specific peptide sequences derived from elastin (VGVPG) and ECM components (SIKVAV, YIGSRG), detailing their structural context and modifications (e.g., incorporation into ABA... 3 claims
US-2012094919-A1 2012 The document provides specific tripeptide sequences and modifications (e.g., Palm-Lys-Val-Lys-OH, Tetradecyl-NH—C(O)-Dab-Val-Dab-OH) which are primary data requirements. Although the patent... 3 claims
US-2012114577-A1 2012 The document describes novel peptide sequences (SEQ ID NO:1 + variants) designed to mimic TGF-β activity, specifically claiming efficacy for 'wrinkle improvement.' It also explicitly lists required... 3 claims
US-2012178901-A1 2012 The document discloses peptide sequences (SEQ ID NOs: 1-4) and their use in promoting tissue remodeling, specifically focusing on angiogenesis and wound healing. Although the primary quantitative... 3 claims
US-2012213845-A1 2012 The document, a patent in the anti-aging domain, explicitly mentions specific, modified peptides (Palmitoyl Oligopeptide, Palmitoyl Tetrapeptide-7) used as fine line reducers. Although the primary... 2 claims
US-2013143802-A1 2013 Document focuses on Elastin-Like Peptides (ELPs) as fusion partners to enhance drug pharmacokinetics (PK). While the tested outcome (PK enhancement) is not elastin stimulation, the document... 3 claims
US-2013295122-A1 2013 The patent directly names specific peptide sequences (PGGVLPG, VGVVPG, IGLGPGGV, GXXPG) and claims they stimulate lysyl oxidase production and enhance elasticity, which is a direct measure of... 3 claims
US-2014044655-A1 2014 The document is a patent describing novel peptides (SEQ ID NOs 1-6) claimed to activate extracellular matrix (ECM) protein synthesis in the skin, which is the mechanism for elastin stimulation.... 3 claims
US-2014100170-A1 2014 The document explicitly identifies several synthetic peptide sequences (e.g., VGAMPG, IGLSPG, VGLSPG, IGAMPG) and linked dimers that are claimed to stimulate elastogenesis and interact with the... 3 claims
US-2014155335-A1 2014 The document, while focusing primarily on non-peptidic polyphenols (ellagic and tannic acid) for elastin protection, explicitly mentions that 'A proteolytic digest of elastin to provide a mixture of... 3 claims
US-2014206842-A1 2014 The document identifies a specific peptide sequence (SEQ ID NO: 1: Lysyl-Threonyl-Threonyl-Lysyl-Serine, KTTKS) and its modifications (Triterpenoid peptides, lipoic acid) used for dermal matrix... 3 claims
US-2014234242-A1 2014 The document explicitly identifies a relevant modified peptide sequence (Palmitoyl tetrapeptide-7) used in compositions for skin firming and wrinkle reduction. These activities are directly linked to... 3 claims
US-2014255951-A1 2014 The document focuses on Lysyl Oxidase-Like 2 (LOXL2), an enzyme essential for elastin cross-linking, which is an adjacent biochemical domain to elastin stimulation. It provides a specific short... 3 claims
US-2014271524-A1 2014 The document is a patent detailing cosmetic compositions using specific peptide sequences and modifications (e.g., palmitoyl oligopeptide, acetyl-hexapeptide-8) for anti-aging, explicitly mentioning... 1 claim
US-2014296155-A1 2014 The document provides specific peptide sequences and modifications required by the goal, namely palmitoyl pentapeptide (KTTLS) and hydrolyzed serecin, used in a formulation targeting skin matrix... 1 claim
US-2014348894-A1 2014 The document identifies and specifies an Elastin-Like Polypeptide (ELP) sequence domain, (VPGXG)n (SEQ ID No: 2), and mentions modifications (Lysine inclusion for crosslinking). This sequence is... 3 claims
US-2014363563-A1 2014 The document explicitly identifies and utilizes blocks of the elastin pentapeptide sequence VGVPG (SEQ ID NO: 1) as part of a novel copolymer structure. The research goal requires capturing peptide... 2 claims
US-2014371154-A1 2014 The document describes novel peptides (SEQ ID NOs: 1-4) intended for use in wound healing and tissue regeneration, which are adjacent domains to elastin stimulation. Although the primary claimed... 3 claims
US-2014377390-A1 2014 The document is a patent describing a cosmetic composition for combating skin aging that utilizes a specific, proprietary peptide (SEQ ID NO: 1). Peptides used for anti-aging often target the... 3 claims
US-2015004184-A1 2015 The document, a patent, directly identifies specific peptide sequences (e.g., PGGVLPG (SEQ ID No. 47), VGVVPG (SEQ ID No. 48), IGLGPGGV (SEQ ID. No. 49)) and explicitly claims they have... 3 claims
US-2015031604-A1 2015 The document provides detailed sequences and complex modifications (acetylation, cyclization, non-natural amino acids) of peptides, which are essential structural data points for the research goal.... 3 claims
US-2015031633-A1 2015 The document describes novel peptide sequences (e.g., (Val-Gly-Val-Ala-Pro-Gly)n, n>=3) that are explicitly claimed to bind to the 'elastin-binding receptor protein' (EBP). Although the main claimed... 3 claims
US-2015056295-A1 2015 The document describes methods for restoring aged skin and improving cosmetic appearance using extracts and purified components, including specific polypeptides. Elastin stimulation is a common... 1 claim
US-2015093346-A1 2015 The document explicitly discloses a specific modified peptide sequence, Palmitoyl tetrapeptide-7, which is claimed to increase skin's elasticity and firmness. Since increased elasticity is directly... 2 claims
US-2015110755-A1 2015 This patent explicitly claims and lists numerous specific peptide sequences (e.g., PGGVLPG, VGVVPG, various VGAPG/IGAPG variants, including dimeric forms) as components of 'elastogenic compositions'... 3 claims
US-2015132235-A1 2015 The document provides specific peptide sequences (SEQ ID No 2) with known modifications (pGlu, Cys residues, C-terminal amide) and concentrations (e.g., 0.05 μM to 0.50 μM). Crucially, the patent... 3 claims
US-2015148297-A1 2015 The document is a patent describing a modified peptide (SEQ ID No. 1 linked to oleanolic acid) tested on human fibroblasts for skin firming and ECM regulation. Claim 5 mentions increasing Lysyl... 3 claims
US-2015218280-A1 2015 The document defines and utilizes specific Elastin-Like Peptide (ELP) sequences (e.g., SEQ ID NOs 6, 7, 14) which are core components of the research goal (peptide sequences tested for elastin... 3 claims
US-2015232523-A1 2015 The document is a patent describing synthetic peptide sequences (PEDF derivatives, including modified versions 'MO') intended to treat skin aging and loss of elasticity by stimulating the... 3 claims
US-2015307546-A1 2015 The document provides explicit peptide sequences, modifications (fusion constructs), and lengths of Elastin-Like Polypeptides (ELP), specifically VPGVG repeats (SEQ ID NOs 1, 3, 4, 5, 20-60 repeats).... 3 claims
US-2015322114-A1 2015 The document explicitly lists several elastin-like peptide (ELP) sequences (VPGVG, VPGDG, VPGEG, VGIPG, VPGIG) which are critical comparison or control sequences for elastin-stimulating studies.... 3 claims
US-2016089415-A1 2016 The document explicitly names a synthetic peptide sequence, Val-Gly-Val-Ala-Pro-Gly (VGVAPG, SEQ ID NO: 19), which is highly relevant to elastin research. Furthermore, the claims and description... 3 claims
US-2016101032-A1 2016 Although the document does not explicitly mention 'elastin-stimulating activity,' it focuses on specific modified peptide sequences (e.g., HRLKR, RLKRL, including N-acetylation and C-amidation) that... 3 claims
US-2016129045-A1 2016 The document explicitly identifies and characterizes core elastin-like peptide sequences (VGVPG) and their specific modifications (e.g., multiblock biopolymer REP: [VGRGD(VGVPG)6]n) used in tissue... 3 claims
US-2016184384-A1 2016 The document describes tetrapeptides designed to treat skin conditions strongly associated with extracellular matrix (ECM) degradation, specifically aging skin, striae distensae (stretch marks), and... 3 claims
US-2016194379-A1 2016 The document explicitly discusses the therapeutic use of 'tropoelastin or elastin derived peptide' for wound healing and re-epithelialization. This places the content directly within the relevant... 3 claims
US-2016222077-A1 2016 The patent claims adiponectin-derived peptides (SEQ ID NOs 1-6) inhibit skin wrinkle formation, explicitly linking this activity to the necessity of forming and maintaining extracellular matrix (ECM)... 3 claims
US-2016228470-A1 2016 The document explicitly discloses the synthesis and concentration (25-100 μM) of specific elastin-like peptide sequences and polymers, such as the VGVPG repeat and the complex biopolymer... 2 claims
US-2016334416-A1 2016 The document provides specific peptide sequences (e.g., FGPGVV, VPGLGV, IKAPKL) derived directly from human elastin (SEQ ID NO:1). While the patent focuses on detecting these sequences as degradation... 3 claims
US-2017002047-A1 2017 The document is a patent describing novel synthetic peptides (e.g., IGVAPG, VGAMPG) and their specific modifications (e.g., N-terminal acetylation) that are claimed to stimulate elastogenesis... 3 claims
US-2017007662-A2 2017 The document provides specific tetrapeptide sequences (e.g., IEKM, VEKF) and modifications (lipidation, amidation) intended for treating aging skin and striae distensae (stretch marks). These... 3 claims
US-2017015885-A1 2017 The document defines specific Elastin-Like Polypeptide (ELP) sequences and incorporates relevant modifications (DOPA, TOPA, specific tags) based on the VPGXG elastin repeat motif. Although the... 3 claims
US-2017087211-A1 2017 The document describes novel polypeptides (HPf, HPfΔC1, HPfΔC2) intended for topical use to improve skin conditions, specifically mentioning 'skin elasticity' and 'skin aging'. These claimed effects... 2 claims
US-2017087252-A1 2017 The document lists various peptide sequences (SEQ ID NOs) and modifications (chelating agents, labels) designed to target senescent cells, specifically mentioning the treatment of 'skin wrinkles'... 2 claims
US-2017157014-A1 2017 The patent directly proposes and claims specific peptide sequences (X-Pro-Pro-Xaa-Y, e.g., Myr-PPL-OH, Myr-PPR-OH) and modifications (e.g., palmitoyle, myristoyle) intended to 'stimulate the... 3 claims
US-2017182130-A1 2017 The document identifies specific Elastin-Like Peptide (ELP) sequences (e.g., VPGXG repeats, specific lengths, and composition ratios, SEQ ID NOs 1-13) that are structurally related to elastin. While... 3 claims
US-2017183386-A1 2017 This patent lists hundreds of bioactive peptide sequences (SEQ ID NOs 1 to 1312) and claims their use in 'preventing ageing of skin' (Claim 12) and for 'cellular growth promoting activity.' Elastin... 3 claims
US-2017190747-A1 2017 The document describes a specific polypeptide sequence (SV82/SEQ ID NO: 2) and explicitly states that it was tested in a skin test to identify 'skin elasticity maintaining effects' and 'skin wrinkles... 3 claims
US-2017233446-A1 2017 The document describes fusion polypeptides (e.g., based on SEQ ID NO:41) intended for treating age-related conditions, specifically mentioning 'skin atrophy' and 'wrinkles.' Since the pathogenesis of... 3 claims
US-2017258931-A1 2017 The document provides specific short peptide sequences (KVK, RGD, 2-5 residues) and relevant modifications (palmitoylation, conjugation) within the domain of anti-wrinkle/ECM repair cosmetics.... 3 claims
US-2017281508-A1 2017 The patent claims disclose multiple specific peptide sequences (SEQ ID NO: 1-16) and their concentrations (e.g., 0.000001% to 5%) for improving skin health. Crucially, Claim 3 explicitly includes... 3 claims
US-2017326089-A1 2017 The document explicitly relates to compositions designed to stimulate the biosynthesis of elastin, directly addressing the core function required by the research goal. Although the primary claimed... 3 claims
US-2017368153-A1 2017 The document describes RGD-containing peptides used for skin wrinkle reduction and promoting collagen synthesis. The background section specifically notes that the dermis contains both collagen and... 3 claims
US-2018000717-A1 2018 The patent explicitly claims that the peptidic compounds 'stimulate the synthesis... of elastin.' It provides specific peptide sequences (e.g., Pal-K(P)-HG-OH, Pal-K(Hyp)-HG-OH), length constraints... 3 claims
US-2018028426-A1 2018 The document provides a specific peptide sequence (P-113) and quantitative results related to its anti-aging/anti-wrinkle activity through ECM modulation (MMP-9 inhibition/collagen preservation).... 2 claims
US-2018050224-A1 2018 The document identifies a specific modified peptide sequence, Palmitoyl Tetrapeptide-7, used in compositions claiming to increase skin elasticity and firming, which is directly relevant to the... 2 claims
US-2018094137-A1 2018 The document explicitly deals with Elastin-Like Peptides (ELPs) and cites specific SEQ ID NOs (1-6, 9). Although the primary application described is structural (contact lens component) rather than... 3 claims
US-2018110713-A1 2018 The document details specific peptide sequences (ELKLIFLHRLKRLRKRLKRK) and critical modifications (N-terminal acetylation, C-terminal amidation) intended for anti-aging via dermal matrix component... 3 claims
US-2018208642-A1 2018 This document describes the structure and sequence of multiple Elastin-Based Polypeptides (EBPs) derived from VPGXG and VPAXG repeats (SEQ ID NOs 1, 2, 20-36, 41-47). Although the primary function... 3 claims
US-2018258140-A1 2018 The document is a patent describing specific peptide sequences (KFNLPLGNYKKP, SEQ ID NO: 1) and their complex chemical modifications (R1/R2 groups including C1-C24 alkyl chains and PEGylation)... 3 claims
US-2018280287-A1 2018 The document investigates a hydrolyzed peptide extract (Sacha Inchi) used for anti-aging, specifically claiming to increase dermal density, restructure connective tissue, and improve skin elasticity.... 2 claims
US-2018291070-A1 2018 The patent claims compositions of specific peptides (SEQUENCE ID NO's 1-1312) used in a method for 'preventing ageing of skin' and possessing 'cellular growth promoting activities.' Elastin... 3 claims
US-2018303880-A1 2018 The document, a patent focused on skin restoration, cosmetic improvement, and anti-aging, explicitly mentions 'polypeptides' and 'proteins' as active components in the compositions. While the... 3 claims
US-2018327464-A1 2018 The document, a patent application, discloses specific peptide sequences (HSP90a, HPf, HPfΔC1, HPfΔC2) and claims their use for 'improving skin conditions' including 'skin elasticity' and 'wrinkles.'... 3 claims
US-2018333467-A1 2018 The document explicitly describes Elastin-Like Peptides (ELPs) using specific repeat units (e.g., VPGXG, SEQ ID NOs: 1-13) and defines their structure (e.g., 120 repeat units). Although the patent... 3 claims
US-2018344608-A1 2018 The document, a patent, focuses on ultra-low molecular weight keratin peptides (SEQ ID NOs 1-9) specifically for preventing or improving skin aging and wrinkles. This is the exact domain where... 3 claims
US-2018360720-A1 2018 The document is a patent disclosing a specific peptide sequence (ProAspSerThrGluAlaLys, SEQ ID NO: 1) and provides experimental evidence in fibroblast cells (CCD-966SK) showing its effect on... 3 claims
US-2019038541-A1 2019 The document explicitly identifies a modified peptide, 'palmitoyl tripeptide 38,' which is claimed to 'enhance collagen and elastin' production. This directly relates to the research goal of... 2 claims
US-2019046599-A1 2019 The document describes hundreds of specific peptide sequences (SEQUENCE ID NO's 15-775) and explicitly states that these peptides have been shown to have an 'effect on elastin and collagen... 3 claims
US-2019062405-A1 2019 The patent relates directly to the use of 'tropoelastin or elastin derived peptide' for biological activity (wound healing/re-epithelialization). Patents are a required source of information for this... 3 claims
US-2019062404-A1 2019 The document defines and uses specific Elastin-Like Polypeptide (ELP) sequences (VPGXG repeats, SEQ ID NOs: 1, 2, 3), which are directly relevant structural analogues to elastin fragments studied for... 3 claims
US-2019083378-A1 2019 The document discloses a specific modified tripeptide sequence (Oleanoyl-KVK, SEQ ID #1) and explicitly claims its efficacy via 'anti-elastase' properties. This information (sequence, modification,... 3 claims
US-2019111103-A1 2019 The document, a patent application, explicitly identifies specific short peptide sequences (Val-Pro-Gly-Gly, Val-Pro-Gly-Ala, Val-Pro) and claims their activity in enhancing elastin production in... 3 claims
US-2019153030-A1 2019 The document, a patent application, explicitly identifies specific modified peptide sequences (e.g., Pal-K(Ac)GH, Pal-K(Ac)HG) and claims their use for improving skin elasticity and being active on... 3 claims
US-2019153045-A1 2019 The document, a patent application, is focused entirely on novel synthetic peptides (e.g., IGVSPG, VGVMPG) derived from plant sources that mimic the elastin receptor ligand motif (GXXPG) and are... 2 claims
US-2019169269-A1 2019 The document defines and claims specific tropoelastin-derived polypeptide sequences (e.g., SEQ ID No. 1, 2, 3, 6, 8) intended for use in tissue regeneration and biocompatible materials. These... 3 claims
US-2019185528-A1 2019 The document discloses specific peptide sequences (elasticity motifs, e.g., GPGGA motif of SEQ ID NO: 2, and other Flagelliform/MaSp/MiSp motifs) that are engineered for their elasticity-conferring... 3 claims
US-2019185523-A1 2019 The document describes specific polypeptides (referenced via SEQ ID NOs) derived from botulinum toxin binding domains. These polypeptides are explicitly claimed to modulate 'extra cellular matrix... 2 claims
US-2019247317-A1 2019 The document provides specific, defined sequences for Elastin-Like Peptides (ELPs) (e.g., G(VPGSG)n(VPGIG)nY) and conjugates (SEQ ID NO: 5-8). While the primary function described is drug delivery... 3 claims
US-2019284248-A1 2019 The document lists over 1,300 bioactive peptides (sequences and modifications are mentioned) and explicitly claims 'cellular growth promoting activities' and 'A method of preventing ageing of skin.'... 3 claims
US-2019321436-A1 2019 The document, a patent application, describes a large number of specific peptide sequences (e.g., SEQ ID NO's 15-505) and explicitly states that these peptides were tested and 'have been shown to... 3 claims
US-2020087374-A1 2020 The document defines numerous peptide sequences (referenced by SEQ ID NOs and structural motifs like PG-domain) that interact with the elastin receptor (EBP). The abstract explicitly states that this... 3 claims
US-2020109369-A1 2020 The document identifies a specific peptide (BMP-2) relevant to skin anti-aging and repair, claiming it helps restore skin elasticity and firmness. While it focuses on the production process, the... 3 claims
US-2020171332-A1 2020 The patent application explicitly discusses the use of a specific modified peptide, palmitoyl tetrapeptide-7, in compositions intended to increase skin elasticity and reduce signs of aging. This... 3 claims
US-2020197472-A1 2020 The document identifies specific peptide sequences (tripeptide-1 and tetradecyl aminobutyroylvalylaminobutyric urea trifluoroacetate, TAUT) as components of a composition designed to stimulate the... 3 claims
US-2020222585-A1 2020 The patent discusses compositions containing elastin peptides prepared via enzymatic hydrolysis and explicitly claims they 'simultaneously and significantly increase the amount of the elastin and... 3 claims
US-2020268618-A1 2020 The document identifies a highly modified oligopeptide ('palmitoyl sh-tripeptide-4 amide') used in skin anti-aging and repair formulations. Although the abstract focuses on clinical outcomes... 2 claims
US-2020282022-A1 2020 The document provides explicit, detailed structural information (sequence, length, repeating units, and specific amino acid ratios: VPGXG repeats, 90-144 units) for Elastin-Like Peptides (ELPs).... 3 claims
US-2020360486-A1 2020 The document details specific amino acid sequences (SEQ ID NO: 1, VPGXG repeats) and their modifications (ELP-C-peptide conjugation, K8/K9 variants) that are tested in a biological system (in vivo/in... 3 claims
US-2020378971-A1 2020 The document provides a specific, defined elastin-derived peptide sequence (LPGGYGLPYT) and detailed information on its context (a degradation marker cleaved by PR3), along with assay details... 2 claims
US-2020392476-A1 2020 The document explicitly names several peptides relevant to skin aging and extracellular matrix remodeling, including Palmitoyl-KTTKS, Cu-GHK tripeptide, Palmitoyl-GHK, and Palmitoyl-GQPR. These... 2 claims
US-2021009637-A1 2021 The patent discloses specific peptide sequences (SEQ ID NOs: 2-15) and explicitly claims their function in "increasing production of elastin." This directly addresses the research goal of identifying... 3 claims
US-2021054048-A1 2021 The document, while focused on purification methods for Elastin-like polypeptides (ELPs), explicitly lists specific ELP sequences (e.g., V12, V24, V24-EGF) derived from elastin in Claim 6 (SEQ ID... 1 claim
US-2021130423-A1 2021 The document describes defined peptide sequences (HPf, HPfΔC1, HPfΔC2, referencing SEQ ID NOs 1, 20, 21) used in compositions (100 ng/ml to 1 mg/ml concentration) for treating skin conditions,... 3 claims
US-2021180070-A1 2021 The document explicitly defines and uses Elastin-Like Polypeptide (ELP) sequences, specifically the general formula (VPGXG)n (Claims 36-38), which are central to the research goal of identifying... 2 claims
US-2021246165-A1 2021 The document is a patent for a peptide designed for cosmetic applications, specifically targeting skin wrinkle improvement and increasing collagen expression. Since elastin is a crucial component of... 1 claim
US-2021277072-A1 2021 The patent directly describes novel peptide sequences (e.g., acetylated VGAMPG, IGLSPG, and linked multimers) and peptidomimetics designed to stimulate elastogenesis. The document provides specific... 2 claims
US-2021309722-A1 2021 The document provides specific peptide sequences for Elastin-Like Polypeptides (ELP), including the general formula (VPGXG)n and specific ratios (e.g., n=120, V:A ratio of 4:1). While the... 3 claims
US-2021338557-A1 2021 The document describes specific short peptide sequences (M(O)VV, M(O)₂VV) and required modifications (oxidation, N-acetylation) tested for improving dermatological signs of aging. The claims... 3 claims
US-2021346458-A1 2021 The document explicitly claims compositions and methods for 'stimulating elastin and/or collagen production.' It names multiple specific peptides (Tripeptide-1, Hexapeptide-12, Hexapeptide-11, Acetyl... 3 claims
US-2021353707-A1 2021 The document, a patent application, describes hundreds of specific peptide sequences (SEQ ID NOs 15-775) derived from pea and rice proteins. The description explicitly states that these peptides... 3 claims
US-2021379409-A1 2021 The document explicitly identifies and utilizes specific modified peptides (Palmitoyl tetrapeptide-7 and Palmitoyl oligopeptide) used in topical compositions for improving skin elasticity and... 3 claims
US-2021395305-A1 2021 The document describes a short peptide (up to 16 amino acids, Seq ID No. 1, possibly NGF1-14 mimetic) and its chemical modifications (acyl, amido, etc.) for use in treating and preventing skin aging.... 3 claims
US-2021395304-A1 2021 The document proposes and claims several specific peptide sequences (e.g., SEQ ID NOs 2-15: RPIK, KNAK, PRPIK) and explicitly states their application in 'increasing production of elastin.' This... 3 claims
US-2022009988-A1 2022 The document focuses on novel peptides (C-peptide, GxxPG motifs, QDEA motifs) that activate or modulate the 'elastin receptor.' The elastin receptor is the key biological target through which classic... 3 claims
US-2022023390-A1 2022 The document defines and tests specific peptide agents (e.g., PB1046, PB1120, and SEQ ID NO: 15) that are described as containing 'one or more elastin-like peptides (ELP).' Although the quantitative... 3 claims
US-2022049236-A1 2022 The document provides specific polypeptide sequences (propeptide of LOX, SEQ ID NO: 1 or 5) and associated modifications (e.g., glycosylation, chimeric fusion) that are centrally involved in ECM... 3 claims
US-2022054388-A1 2022 The document investigates specific peptide sequences (SEQ ID NO: 1 to 6) for anti-aging and improving skin elasticity/collagen density, which is a highly relevant adjacent domain to elastin... 3 claims
US-2022098281-A1 2022 The document investigates the use of 'tropoelastin or elastin derived peptide' for biological application (wound healing/scar treatment). Although the claims focus on the full protein (tropoelastin)... 3 claims
US-2022151882-A1 2022 The document is a patent that identifies a specific modified oligopeptide, 'palmitoyl sh-tripeptide-4 amide,' used in anti-aging and skin repair formulations at a defined concentration (0.0001% w/w).... 2 claims
US-2022233424-A1 2022 The document identifies specific modified peptide sequences (palmitoyl dipeptide-7 (pal-KT) and acetyl tetrapeptide-11 (ac-PPYL)) aimed at 'ECM repair and renewal processes.' Elastin synthesis is a... 3 claims
US-2022289801-A1 2022 The document discloses specific peptide sequences (e.g., PRCWRGEGGGGIVRRADRAAVPGGGGRGD, SDKPGGGGTSLDASIIWAMMQNGGGGLSKL) and a modification (Acetylation mentioned in the abstract) intended for... 3 claims
US-2022288170-A1 2022 The document explicitly utilizes Elastin-Like Peptides (ELPs) containing VPGXG repeats (SEQ ID NO: 3 and SEQ ID NO: 15) as part of a therapeutic agent. It provides sequences and quantitative... 2 claims
US-2022305299-A1 2022 The document explicitly names a modified peptide, 'palmitoyl tetrapeptide-7,' and associates its use with improving skin elasticity and firmness, which is directly related to the research goal of... 2 claims
US-2022323534-A1 2022 The document is a patent describing cosmetic/dermatological compositions targeting skin aging, which involves loss of elasticity and 'elastolysis of elastic fibers' (mentioned in the Description).... 3 claims
US-2022401343-A1 2022 The document explicitly identifies a specific modified peptide sequence, Palmitoyl KTTKS (Pal-KTTKS), and claims its utility in 'promoting extracellular matrix synthesis' and 'promoting fibrillin... 3 claims
US-2022409512-A1 2022 The document explicitly identifies a relevant modified peptide sequence (Palmitoyl-KTTKS or Pal-KTTKS) and lists its intended biological activity as promoting extracellular matrix synthesis,... 3 claims
US-2023064303-A1 2023 The document explicitly identifies a specific modified peptide sequence (Palmitoyl KTTKS, SEQ ID NO. 2) and claims its use in promoting extracellular matrix synthesis, increasing resilience, and... 3 claims
US-2023089559-A1 2023 The document is a patent describing compositions containing multiple specific tri-, tetra-, and hexapeptides (including modified forms like Palmitoyl Tripeptide-1, Palmitoyl Hexapeptide-12, and... 3 claims
US-2023093611-A1 2023 The document describes the production of recombinant peptides and polypeptides comprising repeat units of amino acids chosen from elastin and its derivatives. Although it focuses on the production... 3 claims
US-2023121324-A1 2023 The document discusses methods involving tropoelastin monomers and various isoforms (including those lacking domains like 26A), which are the direct molecular precursors to elastin. It explicitly... 3 claims
US-2023148647-A1 2023 The document is a patent claiming a composition for promoting the biosynthesis of elastin, a topic directly central to the research goal. While the primary components listed are individual amino... 3 claims
US-2023165774-A1 2023 The document provides specific modified peptide sequences (palmitoyl dipeptide-7, acetyl tetrapeptide-11) and quantitative results (synergy factors, concentrations, ATP assay) tested for improving... 3 claims
US-2023173030-A1 2023 The document explicitly utilizes an Elastin-Like Peptide (ELP) component fused with Vasoactive Intestinal Peptide (VIP), referenced by SEQ ID NO: 3. Although the primary function described is... 3 claims
US-2023173089-A1 2023 The document describes synthetic peptides (e.g., LQGV, AQGV, and composite structures like ɸn xGxxPG) specifically designed to target the elastin receptor complex (ER). These sequences contain the... 3 claims
US-2023183289-A1 2023 The document discloses a specific tetrapeptide sequence (Gly-Gln-Val-Ser) and reports its activity in combating skin aging, specifically through the inhibition of elastase (an enzyme that degrades... 3 claims
US-2023233438-A1 2023 The document explicitly identifies specific peptide sequences (KTTKS, GHK) and a crucial modification (palmitoyl-KTTKS) relevant to Extracellular Matrix (ECM) biology. Although it claims 'promoting... 3 claims
US-2023249008-A1 2023 The document explicitly names and utilizes a specific modified peptide, 'palmitoyl tetrapeptide 7', for the purpose of 'firming skin' and reducing wrinkles, outcomes directly related to increased... 2 claims
US-2023255875-A1 2023 The document, a patent, deals directly with compositions using tropoelastin (the peptide precursor to elastin) and claims the functional outcome of increasing the formation of elastin fibers (Claim... 3 claims
US-2023302302-A1 2023 The document explicitly discusses the application and efficacy of a specific modified peptide, palmitoyl tetrapeptide-7. The intended effects (firming skin, increasing elasticity) are directly linked... 3 claims
US-2023346875-A1 2023 The document explicitly states that the described compositions and methods are for 'stimulating elastin and/or collagen production.' It lists specific modified peptides (e.g., tripeptide-1,... 3 claims
US-2023355704-A1 2023 The document describes hundreds of specific peptide sequences (SEQ ID NOs: 15-775) and explicitly states that these peptides 'have been shown to have an effect on elastin and collagen production and... 3 claims
US-2023365643-A1 2023 The document describes adiponectin-derived peptides intended for improving skin wrinkles by promoting extracellular matrix (ECM) components. Elastin stimulation is a core mechanism for anti-wrinkle... 3 claims
US-2023398049-A1 2023 Although the primary novel peptides patented focus on collagen/fibronectin stimulation, the background section explicitly sequences and describes the activity of established elastin-stimulating... 2 claims
US-2023399359-A1 2023 The document is highly relevant as it explicitly cites and provides the sequence and modification (Pal-VGVAPG, SEQ ID No 3) for a known peptide marketed specifically for its ability to stimulate... 3 claims
US-2023406896-A1 2023 The document is a patent application describing compositions containing specific, chemically modified peptides (e.g., Acetyl Octapeptide-17 Amide, Caproyl Tetrapeptide-3) intended for repairing or... 3 claims
US-2024000898-A1 2024 The document, a patent, focuses entirely on methods to restore elasticity and form elastin fibers using tropoelastin monomers, variants, or compositions. It explicitly references a Sequence Listing,... 3 claims
US-2024010677-A1 2024 The document, while patenting a novel peptide (LLAN), explicitly references and lists previously known modified peptide sequences (Pal-VGVAPG and Ac-YR-hexadecyl ester) and their known function as... 2 claims
US-2024010682-A1 2024 The document defines and provides sequences for multiple Elastin-Like Polypeptides (ELPs) and their functional blocks (SEQ ID NOs 003-012). While the stated primary function is hemostasis, the... 3 claims
US-2024025948-A1 2024 The document, while focused on peptide adhesives, lists several specific peptide sequences (SEQ ID NOs 26-28) designated as 'elastic conferring sequences' or those that confer 'elastomeric... 3 claims
US-2024027431-A1 2024 The document investigates specific peptide sequences (including C-peptide fragments and synthetic peptides defined by SEQ ID NOs) that act as agonists for the 'elastin receptor.' Elastin receptor... 3 claims
US-2024027466-A1 2024 Although the document does not report peptide sequences, it details a specific, patented High-Performance Liquid Chromatography (HPLC) method for isolating and quantifying desmosine and isodesmosine.... 1 claim
US-2024043471-A1 2024 The document describes a tetrapeptide sequence (GQVS) synthesized for 'anti-wrinkle activity.' The patent background explicitly identifies the loss of elastin as a key cause of skin aging and loss of... 3 claims
US-2024082134-A1 2024 The document introduces a specific peptide sequence (QHREDGS, SEQ ID NO: 1) intended for skin anti-aging treatments. Claim 2 explicitly states that the peptide's method of use results in 'increasing... 3 claims
US-2024173237-A1 2024 The document investigates Fibroblast Growth Factor 17 (FGF 17) for promoting the synthesis of elastin in fibroblasts and references specific figures (FIG. 7) showing quantitative measurements (gene... 1 claim
US-2024180996-A1 2024 This patent directly describes compositions and methods for 'stimulating elastin production' and 'stimulating elastogenesis' using specific peptides (tripeptide-1, hexapeptide-12, hexapeptide-11,... 3 claims
US-2024189477-A1 2024 The document deals directly with methods for elastic fiber formation (elastogenesis) using fibroblasts and tropoelastin, which establishes the required biological context and methods (cell type,... 3 claims
US-2024218388-A1 2024 The document provides a specific sequence (SEQ ID NO: 25, 'partial human elastin') used as a target product. It also reports quantitative outcomes (non-cytotoxicity, increased expression of hHAS2,... 2 claims
US-2024261204-A1 2024 The document describes a novel modified peptide (Ascorbic acid polypeptide derivative, specifically EAC-L-carnosine) tested for anti-aging effects, including improving 'skin elasticity.' It provides... 3 claims
US-2024279276-A1 2024 The document reports a specific peptide sequence (YLP) and its anti-aging activity, including positive effects on key components of the dermal extracellular matrix (Type I collagen and hyaluronic... 3 claims
US-2024279277-A1 2024 The document discloses a specific peptide sequence (GQVS, SEQ ID NO: 1) and its biological activity relevant to dermal structure and elasticity. While the primary mechanism cited is elastase... 3 claims
US-2024327781-A1 2024 The document defines specific Elastin-Like Peptide (ELP) sequences (SEQ ID NOs 1, 2, 3, and their multimers) which fall directly within the scope of molecules investigated for elastin-stimulating... 2 claims
US-2024407993-A1 2024 The patent claims and description explicitly state that the novel peptide (SEQ ID NO: 1) increases the expression or secretion of elastin in cells (specifically skin fibroblasts), which directly... 2 claims
US-2024409584-A1 2024 The document, a patent, directly claims and references data (Claim 7, Claim 8, and the description of Figure 1A) demonstrating that the described peptide (SEQ ID NO: 1) increases the expression of... 2 claims
US-2024415756-A1 2024 The patent explicitly claims novel peptide sequences (4-8 amino acids, including variable R1/R2 modifications) that are 'capable of maintaining and/or synthesizing ECM.' Claim 6 further specifies... 2 claims
US-2025018001-A1 2025 This patent describes numerous peptide sequences (SEQ ID NOs 1-704) and their chemical modifications intended for use in anti-aging applications by stimulating the biosynthesis of the extracellular... 3 claims
US-2025025525-A1 2025 The document, a patent application, lists several specific short peptide sequences (SEQ ID NOs: 1-7, octapeptides derived from elastin/collagen features) and explicitly claims methods using these... 3 claims
US-2025032532-A1 2025 The document identifies several specific octapeptide sequences (SEQ ID NOs 1-7) and related peptides (hexapeptide-11, hexapeptide-12) used in topical compositions. Claim 17 explicitly lists one of... 3 claims
US-2025064707-A1 2025 The document, specifically Claim 7 and the Description, states that the tested peptide (SEQ ID NO: 1) is part of a composition that 'increases expression or secretion of collagen, fibronectin, or... 2 claims
US-2025065011-A1 2025 The document is a patent disclosing explicit sequences of synthetic Elastin-Like Polypeptides (ELPs) (e.g., SEQ ID NO: 11, 12) designed as elastin mimetics for tissue repair. Although the reported... 3 claims
US-2025074969-A1 2025 The document claims that the novel recombinant collagen polypeptides (derivatives of SEQ ID NO: 2) have 'elasticity-promoting activities.' Patents that make such claims usually include experimental... 3 claims
US-2025123275-A1 2025 The document discusses novel peptides (including specific sequences and modifications like retro-inverso variants and GxxPG motifs) that are designed to agonize the elastin receptor. The elastin... 3 claims
US-2025171503-A1 2025 The document discusses and specifies sequences of Elastin-Like Polypeptides (ELPs), such as (VPGXG)m (SEQ ID NO: 34). Although the peptides are used here for purification (based on phase... 3 claims
US-2025171522-A1 2025 The document, a patent, explicitly discusses the use of 'tropoelastin or elastin derived peptides' for therapeutic application (wound healing). Patents are a required source for the research goal,... 3 claims
US-2025197447-A1 2025 The patent claims a specific peptide (SEQ ID NO: 1) and a composition comprising it increases the expression of 'elastin' (Claim 8) in 'skin fibroblasts' (Claim 6). This directly addresses the... 3 claims
US-2025188150-A1 2025 The patent document identifies specific short peptide sequences (e.g., RPKDS, DGKTY) derived from Lysyl Oxidase (LOX) target sites on Extracellular Matrix proteins. Claim 7 explicitly lists the... 3 claims
US-2025302962-A1 2025 The document provides explicit, specific sequences (e.g., SEQ ID Nos: 9-13) of highly modified Elastin-Like Polypeptides (ELPs) derived from the VPGXG motif, including complex chemical modifications... 3 claims
US-2025325638-A1 2025 The patent addresses the restoration of elasticity using tropoelastin, which is the precursor for elastin, and defines concentrations (e.g., Claim 11: 1 μg/ml to 100 mg/ml) and cell types (Claim 20:... 2 claims
US-4132746-A 1979 The document provides explicit details regarding the sequence, length (10 to 100 units), modifications (Lysine and Glutamic acid substitutions for Val4), and polymerization/cross-linking of synthetic... 3 claims
US-4589882-A 1986 The document explicitly names and claims specific short peptide sequences (e.g., L-Val-L-Pro-Gly-L-Val-Gly and chemotactic fragments like Ala-Pro-Gly-Val-Gly-Val-) used in synthetic bioelastomers.... 3 claims
US-4693718-A 1987 The patent discloses specific peptide sequences (e.g., AGVPGFGVG) derived from or related to tropoelastin, which are claimed to stimulate chemotaxis specifically toward 'elastic fiber synthesizing... 3 claims
US-4870055-A 1989 The document identifies and characterizes key peptide sequences (APGVGV, VPGVG, VPGG) derived from tropoelastin, which are the fundamental structural components often tested for elastin-stimulating... 3 claims
US-4960423-A 1990 The document investigates the biological activity of specific complex elastin hydrolysates (α-elastin, K-elastin) at defined concentrations (≈6.2 μg/cm²) on a specific cell type (endothelial cells).... 3 claims
US-4976734-A 1990 The document discloses specific synthetic peptide sequences (e.g., (AGVPGLGVG)n, (AGVPGFGVG)m, H-GFGVGAGVP-OH) that are direct derivatives of tropoelastin repeats. Although the claimed activity is... 3 claims
US-5064430-A 1991 The document defines a family of polynonapeptides structurally derived from elastin/tropoelastin repeating units (VPGX motifs). It explicitly states these peptides 'have increased elastic moduli' and... 3 claims
US-5336256-A 1994 The document utilizes and characterizes specific elastin-derived peptide sequences (e.g., (VPGVG)n and lysine-containing polypentapeptides) which are highly relevant to the research goal. While the... 3 claims
US-5726153-A 1998 The document describes synthetic peptides derived from or 'sufficiently duplicative' of regions of elastin proteins for diagnostic use (Abstract, Claim 20). While the reported activity is vascular... 3 claims
US-5955055-A 1999 The document investigates synthetic peptides that are sequence-duplicative of regions of elastin proteins. Although the reported activity is related to binding/accumulation at injury sites... 3 claims
US-6069129-A 2000 The document, a patent, directly claims and specifies several peptide sequences (SEQ ID NOs 17, 18, 19, 23, including the modified peptide VGV[Hyp]G) that are designed and utilized to 'increase the... 3 claims
US-6127166-A 2000 The document provides specific amino acid sequences (SEQ ID NOS: 6, 7, 8, 9) of glycine-rich peptides (abductin) derived from a highly resilient protein structurally analogous to elastin. It... 3 claims
US-6423333-B1 2002 The document utilizes and names specific repetitive peptide sequences derived from elastin, notably GVGVP, and describes their incorporation into biomaterials via modification (lysine/arginine... 3 claims
US-6506731-B1 2003 This patent directly describes and claims the use of specific low molecular weight peptides (referenced by SEQ ID 66-75 and a general R1-LGAGGA-G-R2 formula) derived from elastin sequences for the... 3 claims
US-6620419-B1 2003 The document defines and claims modified peptides (e.g., Palmitoyl-Lys-Thr-Thr-Lys-Ser, fulfilling the sequence and modification requirements) intended for use in cosmetic compositions against skin... 3 claims
US-6777389-B1 2004 The document is a patent focused on therapeutic compositions using elastin-derived peptides (41 distinct SEQ IDs are listed) intended to treat conditions that would benefit from increased elastin... 3 claims
US-6794362-B1 2004 The patent directly introduces specific peptide sequences (SEQ ID 55-65) that are claimed to enhance tissue elasticity and turgor, fulfilling the requirement to identify reported peptides tested for... 3 claims
US-6809075-B1 2004 This patent focuses on compositions containing specific peptide sequences (referenced by SEQ ID numbers) derived from elastin, claiming they enhance tissue elasticity and appearance. This directly... 3 claims
US-6858201-B2 2005 The document describes the use of metal-peptide complexes (Copper(II) and Tin(II)) derived from, or chemically synthesized to replace, elastin hydrolyzates. This directly addresses the research... 3 claims
US-6906036-B2 2005 The document describes peptides designed to inhibit matrix metalloproteinases (MMPs) and stimulate cellular proliferation, including fibroblasts. These peptides are explicitly claimed for use in... 2 claims
US-6962904-B1 2005 This document (a patent) directly addresses the research goal by listing multiple specific peptide sequences (e.g., GAVVPQ, VVPQ) and their associated chemical modifications (Acetyl, Amide, Cysteine... 3 claims
US-7001328-B1 2006 The background section explicitly identifies the crucial elastin-derived cell binding sequence, VGVAPG, and describes its function in suppressing smooth muscle cell phenotypic transition by... 2 claims
US-7196162-B2 2007 The document provides specific peptide sequences (SEQ ID NO: 2, 6, 7) intended for anti-aging and promoting healthy skin, addressing issues like wrinkling and degradation of elastin fibers (actinic... 1 claim
US-7211269-B2 2007 The document claims that the peptide sequence (Gly-Pro-Gln)n-NH2, along with its terminal amide modification (-NH2) and potential D/L amino acid configurations, is designed to increase the expression... 2 claims
US-7396815-B2 2008 The document introduces novel peptide sequences (SEQ ID NO: 1 and 2) explicitly designed to treat cutaneous aging by acting on the extracellular matrix (ECM), specifically listing 'elastin' as one of... 3 claims
US-7459166-B2 2008 The document identifies a specific peptide sequence (Palmitoyl-gly-his-lys) and its modification (palmitoylation), which is used in a composition aimed at improving skin elasticity and counteracting... 2 claims
US-7560430-B2 2009 The patent directly names and claims specific peptide sequences (PGGVLPG, VGVVPG, IGLGPGGV) that are used in compositions intended to 'stimulate the endogenous synthesis and deposition of Elastin'... 3 claims
US-7566693-B2 2009 The document lists 17 specific hexapeptide sequences (SEQ ID NO: 1-17) related to elastin fragments (VGVAPG motifs) that are claimed for use in compositions and methods for 'protecting elastin fibers... 3 claims
US-7666829-B2 2010 The document explicitly lists 22 specific GXXPG pentapeptide sequences (SEQ ID NO: 1-22), including variants with hydroxyproline modifications (G3Hyp3HypPG, G4Hyp4HypPG), which are claimed to induce... 2 claims
US-7674451-B2 2010 The patent claims the use of specific peptide sequences (RGS variants, (AA)n-Arg-Gly-Ser-(AA)n) and their derivatives/modifications (acetylation, amidation) for treating loss of elasticity and... 1 claim
US-7700110-B2 2010 The document describes compositions containing specific modified peptides (e.g., palmitoyl wheat protein hydrolysate, dipalmitoylhydroxy proline, dipeptide diamincobutyroyl benzamide diacetate,... 3 claims
US-7700126-B2 2010 The document discusses engineered materials using human recombinant tropoelastin fragments and chemically modified tropoelastin (acetylated, methylated, pegylated, or linked to a peptide linker).... 3 claims
US-7723308-B2 2010 The patent claims and describes specific novel peptide sequences (sextapeptides like IGAMPG and their linked dimers) designed to serve as functional ligands for elastin receptors and stimulate... 2 claims
US-7744932-B2 2010 The document explicitly names two peptides, 'dipeptide valyl-tryptophane' and 'palmitoyl tetrapeptide-3,' which are used in compositions addressing skin aging, elasticity loss, and sagging.... 3 claims
US-7803522-B2 2010 The document, a patent, directly identifies and claims the use of numerous specific synthetic elastin peptide sequences (e.g., PGGVLPG, VGVVPG, VGAMPGAAAAAVGAMPG) for stimulating elastogenesis and... 3 claims
US-7807625-B2 2010 Discloses specific acylated hexapeptide sequence (Palmitoyl hexapeptide-6/FALLKL) intended for improving the dermal fibroblast matrix and fibroblast regulation. Elastin is a key component of the... 3 claims
US-7851449-B2 2010 The document reports a specific peptide sequence (KED) and quantitative activity data related to enhancing vascular wall durability and capillaries resistance, including results from vascular wall... 2 claims
US-7887858-B2 2011 The document, focused on cosmetic formulations for skin elasticity and firmness, explicitly names and describes peptides known to act on the dermal extracellular matrix, including 'palmitoyl... 1 claim
US-7906616-B2 2011 The document provides specific polypeptide sequences (SEQ ID NOs 6, 10, 14) derived from cleaved DANCE (Fibulin-5), a protein essential for elastic fiber formation (elastogenesis). The patent... 3 claims
US-8029816-B2 2011 The document explicitly uses and defines the elastin pentapeptide VGVPG (SEQ ID NO:1) as a block in a copolymer coating for medical devices. It also details relevant modifications and linkages (e.g.,... 3 claims
US-8048456-B2 2011 The patent explicitly discloses the composition and use of a modified peptide, 'palmitoyl tetrapeptide-7,' for skin firming and anti-wrinkle treatment. This fits the required criteria of capturing... 3 claims
US-8097581-B2 2012 The document provides specific peptide sequences (Phe Ala Leu Leu Lys Leu / Palmitoyl-Hexapeptide-14), modifications (palmitoylation, C-terminal carboxamide), and intended function (rebuilding the... 3 claims
US-8114829-B2 2012 The document explicitly lists 17 specific peptide sequences (SEQ ID NO: 1 through 17) used in methods targeting dermal elastic fibers and reducing skin damage, which is highly relevant to identifying... 1 claim
US-8252740-B2 2012 The document defines and uses an Elastin-Like Polypeptide (ELP) characterized by the repeating sequence XGVPG (SEQ ID NO: 1). This motif is structurally core to elastin research. Although the patent... 3 claims
US-8383594-B2 2013 The document discloses a specific modified peptide sequence (Oleanolic acid-Lysyl-Threonyl-Threonyl-Lysyl-Serine) explicitly aimed at regenerating the dermal matrix and boosting 'other matrix... 3 claims
US-8461113-B2 2013 The document reports specific peptide sequences (e.g., PGGVLPG, VGVVPG, IGLGPGGV) and claims their efficacy in stimulating the production of Elastin and related components (fibrillin). This directly... 3 claims
US-8507441-B2 2013 The document discloses specific peptide sequences (C-terminal endostatin fragments) with defined lengths and modifications (amidation) that exhibit anti-fibrotic activity by regulating extracellular... 1 claim
US-8518105-B2 2013 The document is centered on protein elastin-based polymers (Elastin-Like Polypeptides, ELPs) used in tissue applications (vessel coating) and explicitly lists several required data points, including... 3 claims
US-8524210-B2 2013 The document, a patent, directly discloses novel synthetic and plant-derived peptide sequences (e.g., VGAMPG, VGLSPG, and their linked/dimeric versions) that are claimed and described as stimulating... 3 claims
US-8642578-B2 2014 The patent explicitly lists 17 specific hexapeptide sequences (SEQ ID NO: 1 through 17, e.g., Val-Gly-Ala-Met-Pro-Gly) that are claimed as 'stimulators of elastogenesis' (Claims 3, 6, 18, 21). This... 2 claims
US-8673840-B2 2014 The document identifies a specific polypeptide sequence (Lopap, defined by SEQ ID NO: 1) used as an anti-aging agent. It explicitly claims that this polypeptide increases the expression of... 3 claims
US-8680246-B2 2014 The document focuses on Lysyl Oxidase-Like-2 (LOXL2) antibodies and associated peptide epitopes (SEQ ID NO:2: TPAMGLQKK). LOXL2 is a crucial enzyme responsible for the cross-linking and maturation of... 3 claims
US-8691300-B2 2014 The document explicitly identifies a specific modified peptide, palmitoyl tetrapeptide-7, which is claimed to increase skin elasticity and firmness. This peptide sequence and its modification... 2 claims
US-8778376-B2 2014 The document describes specific elastin-derived peptide sequences (VGVPG, SEQ ID NO:1) and detailed chemical modifications (copolymerization with PEG, PLA, PC, etc.) used in biomedical applications.... 1 claim
US-8808365-B2 2014 The document, a patent, explicitly lists and claims specific chemically modified tropoelastin molecules (e.g., acetylated tropoelastin, pegylated tropoelastin, methylated tropoelastin) and... 3 claims
US-8809276-B2 2014 The document discloses specific synthetic peptide sequences (SEQ ID NOs 1, 2, 3, 5, 6) with defined modifications (C-terminal amidation) that activate 'extracellular matrix protein synthesis' in skin... 3 claims
US-8828927-B2 2014 The document explicitly provides specific elastin peptide sequences (PGGVLPG, VGVVPG, IGLGPGGV) and claims their use in methods of stimulating elastin production and enhancing tissue elasticity,... 3 claims
US-8865651-B2 2014 The document provides specific sequences and detailed modifications (Palmitoylation, Acetylation) for peptides (SEQ ID NO: 7, 8, Pal-KVK) designed to stimulate dermal extracellular matrix synthesis... 3 claims
US-8871707-B2 2014 The patent directly names and lists multiple specific peptide sequences (e.g., PGGVLPG, VGVVPG, various repeat sequences) claimed to function as 'elastogenic agents' to stimulate cultured dermal... 3 claims
US-8895082-B2 2014 The document explicitly identifies a specific modified peptide, 'palmitoyl tetrapeptide 7,' used in an application (skin firming/anti-wrinkle) directly linked to extracellular matrix components like... 2 claims
US-8940868-B2 2015 The document defines specific Elastin-Like Peptide (ELP) sequences (e.g., YSPGVG, SEQ ID NO:3) which are structural analogs of natural elastin repeats. Although the primary function described is drug... 3 claims
US-8987212-B2 2015 The document explicitly identifies a specific peptide sequence (SEQ ID NO: 1) and modification (linked to oleanolic acid) related to the elastin system. Although the primary activity claimed is... 3 claims
US-9006170-B2 2015 The document, a patent, directly claims therapeutic compositions using specific peptide sequences (GXXPG variants, including GAAPG, GVVPG, and modified sequences like G3Hyp3HypPG and G4Hyp4HypPG)... 3 claims
US-9067972-B2 2015 The document provides specific peptide sequences (NIPPL, VPPF, PVVVP P, etc.) that are structurally related to known elastin-derived peptides, and are designed for skin aging treatment and ECM... 3 claims
US-9115212-B2 2015 The document describes bifunctional peptides containing the VGVAPG motif (a known elastokine sequence derived from elastin) which is claimed to bond to an 'elastin-binding receptor protein.' Although... 3 claims
US-9125843-B2 2015 The document lists specific synthetic peptide sequences (SEQ ID 1-8) along with their modifications (amidation, -NH2) and application concentrations in the relevant domain of skin anti-aging/ECM... 3 claims
US-9127047-B2 2015 This document defines and uses various lengths and compositions of Elastin-Like Peptides (ELPs) (e.g., VPGXG repeats) as fusion proteins. While the stated function in the patent is half-life... 3 claims
US-9254300-B2 2016 The document explicitly identifies a specific peptide sequence (Val-Gly-Val-Ala-Pro-Gly / SEQ ID NO: 19) and claims its use in a composition designed to increase the deposition of insoluble elastin... 3 claims
US-9314488-B2 2016 The document describes methods for restoring aged or damaged skin using cellular extracts that contain 'purified nucleic acids, polypeptides, lipids, carbohydrates or other natural products.' Skin... 1 claim
US-9375395-B2 2016 The document is highly relevant to the core activity being researched (tropoelastin promotion/elastin-stimulating activity) and discusses quantitative outcomes related to this mechanism. While the... 3 claims
US-9422334-B2 2016 This patent directly describes and claims novel synthetic and plant-derived peptide sequences (e.g., IGVAPG, VGVAPGAAAAAVGVAPG) specifically designed and claimed to stimulate elastogenesis and act as... 3 claims
US-9458197-B2 2016 The patent directly addresses the research goal by identifying specific elastin peptide sequences (PGGVLPG, VGVVPG, IGLGPGGV) that are claimed to stimulate the endogenous production of Elastin and... 3 claims
US-9475857-B2 2016 The patent claims therapeutic use for age-related conditions affecting the skin, specifically listing 'skin atrophy' and 'wrinkles.' These applications often rely on modulating extracellular matrix... 3 claims
US-9624286-B2 2017 The document identifies novel peptide sequences (SEQ ID NOs 1-6) designed to promote extracellular matrix (ECM) formation and reduce skin wrinkles. The Background Art section specifically highlights... 2 claims
US-9682118-B1 2017 The document contains detailed definitions of specific Elastin-Like Polypeptide (ELP) sequences (VPGXG repeated 30-200 times) and their fusion with various CPPs, which are central to the structural... 3 claims
US-9693947-B1 2017 The document explicitly states that the composition includes anti-aging peptides (specifically identifying Oligopeptide-24) intended to 'enhance collagen and elastin.' This directly addresses the... 1 claim
US-9815878-B2 2017 This patent discloses specific synthetic peptide sequences (SEQ ID NOs 1-9) of defined lengths (20-39 mers) and modifications ('MO'). These peptides are claimed to stimulate collagen synthesis and... 3 claims
US-9833642-B2 2017 The document explicitly identifies a modified peptide sequence (Palmitoyl tetrapeptide-7) used in compositions claiming to firm skin and increase elasticity. Elastin stimulation is a primary... 3 claims
US-9850278-B2 2017 The document reports on short synthetic peptides (FKE, YKE) and their modifications (acetylation, amidation) used to inhibit inflammation-induced fibrosis and scar formation. Although the primary... 3 claims
US-9872825-B2 2018 The document reports specific peptide sequences (ELKLIFLHRLKRLRKRLKRK) and critical modifications (N-acetylation, C-amidation) tested for anti-aging effects through ECM remodeling (fibroblast growth,... 3 claims
US-9879060-B2 2018 The research goal seeks peptides tested for 'elastin-stimulating activity.' This patent describes a specific polypeptide (SV82, SEQ ID NO: 2) used in a cosmetic composition for 'reducing skin... 3 claims
US-9956263-B2 2018 The document is a patent describing novel polypeptides (HPf, HPfΔC1, HPfΔC2, identified by SEQ ID NOs) used in topical formulations specifically for improving 'skin elasticity' and 'skin aging.'... 3 claims
US-9999649-B2 2018 The document reports detailed quantitative results for a specific modified peptide (Pal-YIGSR) and unmodified peptide (YIGSR) regarding Extracellular Matrix (ECM) synthesis (collagen) in dermal... 3 claims
US-9999639-B2 2018 The patent addresses improving skin health and restoring aged skin using agents that include 'purified or synthetic nucleic acid sequences, polypeptides, or natural products contained in the... 3 claims

💬

Need insights from these experts?

Has email 558 with email · 627 total

Duca, Laurent

6 papers · 16 claims

Elastin · Derived · Peptides · Human · Peptide

pascal.maurice@univ-reims.fr

Claims from this researcher:

+ 11 more claims

Blaise, Sébastien

5 papers · 14 claims

Elastin · Derived · Peptide · Activity · Human

pascal.maurice@univ-reims.fr

Claims from this researcher:

+ 9 more claims

Maurice, Pascal

5 papers · 14 claims

Elastin · Derived · Peptide · Activity · Human

pascal.maurice@univ-reims.fr

Claims from this researcher:

+ 9 more claims

Martiny, Laurent

🔗 ORCID

5 papers · 13 claims

Elastin · Derived · Peptides · Human · Peptide

pascal.maurice@univ-reims.fr

Claims from this researcher:

+ 8 more claims

Brassart, Bertrand

5 papers · 12 claims

Vgvapg · Elastin · Peptide · Tumor · Derived

laurent.debelle@univ-reims.fr

Claims from this researcher:

+ 7 more claims

Romier-Crouzet, Béatrice

4 papers · 11 claims

Elastin · Peptide · Activity · Derived · Sialidase

laurent.duca@univ-reims.fr

Claims from this researcher:

+ 6 more claims

Brassart-Pasco, Sylvie

4 papers · 10 claims

Elastin · Peptide · Tumor · Agvpglgvg · Cell

bertrand.brassart@univ-reims.fr

Claims from this researcher:

+ 5 more claims

Hornebeck, William

3 papers · 9 claims

Elastin · Peptide · Activity · Acid · Kappa

Claims from this researcher:

+ 4 more claims

Bennasroune, Amar

3 papers · 8 claims

Peptide · Elastin · Activity · Derived · Level

pascal.maurice@univ-reims.fr

Claims from this researcher:

+ 3 more claims

Debelle, Laurent

🔗 ORCID

3 papers · 8 claims

Elastin · Derived · Vgvapg · Peptides · Activity

laurent.debelle@univ-reims.fr

Claims from this researcher:

+ 3 more claims

Ramont, Laurent

3 papers · 8 claims

Tumor · Elastin · Agvpglgvg · Peptide · Vgvapg

bertrand.brassart@univ-reims.fr

Claims from this researcher:

+ 3 more claims

Dulińska-Molak, Ida

2 papers · 6 claims

Anti · Wrinkle · Tested · Tripeptide · Activity

ida.dulinska@gmail.com

Claims from this researcher:

+ 1 more claims

Eris, Irena

2 papers · 6 claims

Anti · Wrinkle · Tested · Tripeptide · Activity

ida.dulinska@gmail.com

Claims from this researcher:

+ 1 more claims

Szychowski, Konrad A.

2 papers · 6 claims

Peptide · Vgvapg · Production · Exposure · Cells

konrad.szychowski@gmail.com

Claims from this researcher:

+ 1 more claims

Gmiński, Jan

2 papers · 6 claims

Peptide · Vgvapg · Production · Exposure · Cells

konrad.szychowski@gmail.com

Claims from this researcher:

+ 1 more claims

Terryn, Christine

2 papers · 6 claims

Elastin · Synthetic · Protein · Monocytes · Peptide

pascal.maurice@univ-reims.fr

Claims from this researcher:

+ 1 more claims

Da Silva, Jordan

2 papers · 6 claims

Agvpglgvg · Peptide · Tumor · Vgvapg · Synthetic

bertrand.brassart@univ-reims.fr

Claims from this researcher:

+ 1 more claims

Scandolera, Amandine

2 papers · 6 claims

Elastin · Derived · Peptides · Peptide · Activity

laurent.duca@univ-reims.fr

Claims from this researcher:

+ 1 more claims

El Btaouri, Hassan

2 papers · 6 claims

Elastin · Derived · Peptides · Peptide · Activity

laurent.duca@univ-reims.fr

Claims from this researcher:

+ 1 more claims

Pandit, Abhay

2 papers · 5 claims

Sequence · Elastin · Peptide · Mice · System

yong.xie301@gmail.com

Claims from this researcher:

Tembely, Dignê

2 papers · 5 claims

Elastin · Human · Monocytes · Kappa · Sialylation

pascal.maurice@univ-reims.fr

Claims from this researcher:

Sartelet, Hervé

🔗 ORCID

2 papers · 5 claims

Elastin · Human · Monocytes · Kappa · Sialylation

pascal.maurice@univ-reims.fr

Claims from this researcher:

Barbulova, Ani

2 papers · 5 claims

Collagen · Kttks · Lysine · Production · Pentapeptide

claudiazappelli@vitalabactive.com

Claims from this researcher:

Apone, Fabio

2 papers · 5 claims

Collagen · Kttks · Lysine · Production · Pentapeptide

claudiazappelli@vitalabactive.com

Claims from this researcher:

Baud, Stéphanie

2 papers · 5 claims

Activity · Peptide · Derived · Vgvapg · Intpep

laurent.debelle@univ-reims.fr

Claims from this researcher:

Bochicchio, Brigida

2 papers · 5 claims

Peptide · Vgvapg · Elastin · Like · Vggvg

laurent.debelle@univ-reims.fr

Claims from this researcher:

Pepe, Antonietta

2 papers · 5 claims

Peptide · Vgvapg · Elastin · Like · Vggvg

laurent.debelle@univ-reims.fr

Claims from this researcher:

Dauchez, Manuel

🔗 ORCID

2 papers · 5 claims

Activity · Peptide · Derived · Vgvapg · Intpep

laurent.debelle@univ-reims.fr

Claims from this researcher:

Antonicelli, Frank

2 papers · 5 claims

Elastin · Peptide · Vgvapg · Kappa · Sequence

Claims from this researcher:

He, Xin

🔗 ORCID

2 papers · 5 claims

Collagen · Matrix · Activity · Potential · Skin

hexin22@mails.tsinghua.edu.cn

Claims from this researcher:

Gao, Xinyu

🔗 ORCID

2 papers · 5 claims

Collagen · Matrix · Activity · Potential · Skin

hexin22@mails.tsinghua.edu.cn

Claims from this researcher:

Xie, Weidong

2 papers · 5 claims

Collagen · Matrix · Activity · Potential · Skin

hexin22@mails.tsinghua.edu.cn

Claims from this researcher:

Gautier, Mathieu

2 papers · 5 claims

Agvpglgvg · Peptide · Tumor · Cancer · Cell

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Ouadid-Ahidouch, Halima

2 papers · 5 claims

Elastin · Peptide · Cell · Synthetic · Derived

mathieu.gautier@u-picardie.fr

Claims from this researcher:

Fadilah, Nur Izzah Md

2 papers · 4 claims

Closure · Incorporating · Wound · Complex · Elastin

izzahfadilah@ukm.edu.my

Claims from this researcher:

Maarof, Manira

2 papers · 4 claims

Closure · Incorporating · Wound · Complex · Elastin

izzahfadilah@ukm.edu.my

Claims from this researcher:

Fauzi, Mh Busra

2 papers · 4 claims

Closure · Incorporating · Wound · Complex · Elastin

izzahfadilah@ukm.edu.my

Claims from this researcher:

Wachi, Hiroshi

2 papers · 4 claims

Elastin · Cells · Nhdf · Tropoelastin · Assembly

seyama@hoshi.ac.jp

Claims from this researcher:

Wang R, Wang Y, Song J, Tan H, Tian C, Zhao D, Xu S, Zhao P, Xia Q.

1 papers · 3 claims

Elastin · Null · Peptide · Synthesis · Hacat

xiaqy@swu.edu.cn

Claims from this researcher:

Zdrada-Nowak, Julita

1 papers · 3 claims

Application · Acetyl · Hexapeptide · Increase · Skin

a.surgiel-gemza@ujd.edu.pl

Claims from this researcher:

Surgiel-Gemza, Agnieszka

1 papers · 3 claims

Application · Acetyl · Hexapeptide · Increase · Skin

a.surgiel-gemza@ujd.edu.pl

Claims from this researcher:

Szatkowska, Magdalena

1 papers · 3 claims

Application · Acetyl · Hexapeptide · Increase · Skin

a.surgiel-gemza@ujd.edu.pl

Claims from this researcher:

Pasikowska, Monika

1 papers · 3 claims

Anti · Wrinkle · Tripeptide · Positive · Activity

ida.dulinska@gmail.com

Claims from this researcher:

Pogoda, Katarzyna

1 papers · 3 claims

Anti · Wrinkle · Tripeptide · Positive · Activity

ida.dulinska@gmail.com

Claims from this researcher:

Lewandowska, Małgorzata

1 papers · 3 claims

Anti · Wrinkle · Tripeptide · Positive · Activity

ida.dulinska@gmail.com

Claims from this researcher:

Lekka, Małgorzata

1 papers · 3 claims

Anti · Wrinkle · Tripeptide · Positive · Activity

ida.dulinska@gmail.com

Claims from this researcher:

Sadgrove, Nicholas J.

1 papers · 3 claims

Active · Signals · Restructuring · Dermis · Strike

david@k11.co

Claims from this researcher:

Batra, S. K.

1 papers · 3 claims

Active · Signals · Restructuring · Dermis · Strike

david@k11.co

Claims from this researcher:

Barreto, David García

1 papers · 3 claims

Active · Signals · Restructuring · Dermis · Strike

david@k11.co

Claims from this researcher:

Rapaport, Jeffrey A.

1 papers · 3 claims

Active · Signals · Restructuring · Dermis · Strike

david@k11.co

Claims from this researcher:

Kim, Da Jung

1 papers · 3 claims

Tested · Substance · Rpkpqqffglm · Peptide · Hydrogel

kimdj1404@biosolutions.co.kr

Claims from this researcher:

Chang, Song Sun

1 papers · 3 claims

Tested · Substance · Rpkpqqffglm · Peptide · Hydrogel

kimdj1404@biosolutions.co.kr

Claims from this researcher:

Lee, Jungsun

1 papers · 3 claims

Tested · Substance · Rpkpqqffglm · Peptide · Hydrogel

kimdj1404@biosolutions.co.kr

Claims from this researcher:

Rombel-Bryzek, Agnieszka

1 papers · 3 claims

Peptide · Vgvapg · Cells · Hours · Exposure

konrad.szychowski@gmail.com

Claims from this researcher:

Dołhańczuk-Śródka, Agnieszka

1 papers · 3 claims

Peptide · Vgvapg · Cells · Hours · Exposure

konrad.szychowski@gmail.com

Claims from this researcher:

Fisher, Neil

1 papers · 3 claims

Mixture · Peptide · Skin · Product · Human

Claims from this researcher:

Carati, Davide

1 papers · 3 claims

Mixture · Peptide · Skin · Product · Human

Claims from this researcher:

Xu C, Cao G, Zhang H, Bai M, Yi X, Qu X.

1 papers · 3 claims

Avellanin · Extracellular · Matrix · Components · Cyclic

xuchang2022@stu.gxtcmu.edu.cn

Claims from this researcher:

Joyce, Kieran

1 papers · 3 claims

Elastin · Sequence · Binds · Receptor · Activating

Claims from this researcher:

Fabra, Georgina Targa

1 papers · 3 claims

Elastin · Sequence · Binds · Receptor · Activating

Claims from this researcher:

Bozkurt, Yagmur

1 papers · 3 claims

Elastin · Sequence · Binds · Receptor · Activating

Claims from this researcher:

Majchrzak W, Motyl I, Śmigielski K.

1 papers · 3 claims

Elastase · Ginseng · Activity · Fermented · Exhibited

ilona.motyl@p.lodz.pl

Claims from this researcher:

Duangjai A, Srivilai J, Nangola S, Amornlerdpison D.

1 papers · 3 claims

Skin · Elasticity · Months · Collagen · Peptides

jukkarin.sr@up.ac.th

Claims from this researcher:

Bocquet, Olivier

1 papers · 3 claims

Elastin · Monocytes · Kappa · Sialylation · Level

pascal.maurice@univ-reims.fr

Claims from this researcher:

Rioult, Damien

1 papers · 3 claims

Elastin · Monocytes · Kappa · Sialylation · Level

pascal.maurice@univ-reims.fr

Claims from this researcher:

Romier, Béatrice

1 papers · 3 claims

Elastin · Monocytes · Kappa · Sialylation · Level

pascal.maurice@univ-reims.fr

Claims from this researcher:

Ma Y, Huang J, Gong J, Li L, Zhao Y, Jin Y, Gu J, Liu H, Wang Y, Sun Y.

1 papers · 3 claims

Peptide · Yytsasgdemvslk · Collagen · Photoaged · Human

prof.wangyi@foxmail.com

Claims from this researcher:

Luo, Tianzhi

🔗 ORCID

1 papers · 3 claims

Like · Peptide · Collagen · Reduction · Temperature

Claims from this researcher:

Puertas-Bartolomé M, Venegas-Bustos D, Acosta S, Rodríguez-Cabello JC.

1 papers · 3 claims

Collagen · Cell · Scaffolds · Vpgvg · Elastic

roca@bioforge.uva.es

Claims from this researcher:

Badilli, Ulya

1 papers · 3 claims

Elastin · Collagen · Palmitoyl · Hexapeptide · Fragment

unuman@pharmacy.ankara.edu.tr

Claims from this researcher:

Inal, Ozge

1 papers · 3 claims

Elastin · Collagen · Palmitoyl · Hexapeptide · Fragment

unuman@pharmacy.ankara.edu.tr

Claims from this researcher:

Xing M, Liu H, Meng F, Ma Y, Zhang S, Gao Y.

1 papers · 3 claims

Complex · Polypeptide · Palmitoyl · Pentapeptide · Formulation

suohuizhang@mail.ipc.ac.cn

Claims from this researcher:

Lee, Changrim (author)

1 papers · 3 claims

Cells · Anti · Nanoworm · Raji · Crosslinking

Claims from this researcher:

Kang, Min-Kyung

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Kim, Dong-Yeon

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Oh, Hyeongjoo

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Kim, Soo-Il

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Oh, Su-Yeon

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Na, Woojin

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Park, Sin-Hye

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Park, Kyungho

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Kim, Jun-Il

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Kim, Ae-Hyang

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Kang, Young-Hee

1 papers · 3 claims

Tripeptide · Glycine · Proline · Hydroxyproline · Cellular

mitholy@hallym.ac.kr

Claims from this researcher:

Lee YI, Lee SG, Jung I, Suk J, Lee MH, Kim DU, Lee JH.

1 papers · 3 claims

Everctptm · Collagen · Significantly · Inhibition · Active

ylee1124@yuhs.ac

Claims from this researcher:

Ren, Sihang

1 papers · 3 claims

Into · Wound · Healing · Recombinant · Fusion

yanglq@lnszjk.com.cn

Claims from this researcher:

Guo, Shuaichen

1 papers · 3 claims

Into · Wound · Healing · Recombinant · Fusion

yanglq@lnszjk.com.cn

Claims from this researcher:

Yang, Liqun

1 papers · 3 claims

Into · Wound · Healing · Recombinant · Fusion

yanglq@lnszjk.com.cn

Claims from this researcher:

Wang, Chenchao

1 papers · 3 claims

Into · Wound · Healing · Recombinant · Fusion

yanglq@lnszjk.com.cn

Claims from this researcher:

Liu Y, Zhang L, Wei W.

1 papers · 3 claims

Peptide · Hydrogel · Residue · Protected · Acetylation

l_yfei@163.com

Claims from this researcher:

Zappelli, Claudia

1 papers · 3 claims

Kttks · Lysine · Collagen · Pentapeptide · Threonine

claudiazappelli@vitalabactive.com

Claims from this researcher:

Colucci, Gabriella

1 papers · 3 claims

Kttks · Lysine · Collagen · Pentapeptide · Threonine

claudiazappelli@vitalabactive.com

Claims from this researcher:

Inacio PAQ, Chaluppe FA, Aguiar GF, Coelho CF, Vieira RP.

1 papers · 3 claims

Hydrolyzed · Collagen · Concentrations · Fibroblast · Proliferation

pedroqinacio@gmail.com

Claims from this researcher:

Cecuda-Adamczewska V, Romanik-Chruścielewska A, Kosowska K, Sokołowska I, Łukasiewicz N, Korycka P, Florys-Jankowska K, Zakrzewska A, Wszoła M, Klak M.

1 papers · 3 claims

Protein · Domains · Coating · Fold · Hours

agaromanik@wp.pl

Claims from this researcher:

Gonzalez de Torre, Israel

1 papers · 3 claims

Containing · Vgvapg · Angiogenic · Cells · Elastin

igonzalez@bioforge.uva.es

Claims from this researcher:

Alonso, Matilde

1 papers · 3 claims

Containing · Vgvapg · Angiogenic · Cells · Elastin

igonzalez@bioforge.uva.es

Claims from this researcher:

Rodriguez-Cabello, Jose-Carlos

1 papers · 3 claims

Containing · Vgvapg · Angiogenic · Cells · Elastin

igonzalez@bioforge.uva.es

Claims from this researcher:

Shen, Wen-Juan

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Tian, Duo-Mei

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Fu, Le

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Jin, Biao

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Liu, Yu

🔗 ORCID

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Xu, Yun-Sheng

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Ye, Yong-Bin

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Wang, Xiao-Bo

🔗 ORCID

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Xu, Xiao-Jun

🔗 ORCID

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Tang, Chun

🔗 ORCID

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Li, Fang-Ping

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Wang, Chun-Fei

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Wu, Gang

🔗 ORCID

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Yan, Le-Ping

1 papers · 3 claims

Rala · Pdna · Complexes · Peptide · Transfection

wangchf26@mail.sysu.edu.cn

Claims from this researcher:

Tofik, Abdulhakim

1 papers · 3 claims

Egfr · Fusion · Nanoparticles · Highest · Tested

Claims from this researcher:

Ibáñez-Fonseca A, Santiago Maniega S, Gorbenko Del Blanco D, Catalán Bernardos B, Vega Castrillo A, Álvarez Barcia ÁJ, Alonso M, Aguado HJ, Rodríguez-Cabello JC.

1 papers · 3 claims

Groups · Elastin · Like · Recombinamer · Chemically

roca@bioforge.uva.es

Claims from this researcher:

Nivison‐Smith, Lisa

1 papers · 3 claims

Cell · Vgvapg · Sequence · Tropoelastin · Binding

Claims from this researcher:

Weiss, Anthony S.

1 papers · 3 claims

Cell · Vgvapg · Sequence · Tropoelastin · Binding

Claims from this researcher:

Wang, Keke

🔗 ORCID

1 papers · 3 claims

Elastin · Derived · Nitric · Oxide · Peptides

gzk@xxmu.edu.cn

Claims from this researcher:

Meng, Xiangguang

1 papers · 3 claims

Elastin · Derived · Nitric · Oxide · Peptides

gzk@xxmu.edu.cn

Claims from this researcher:

Guo, Zhikun

1 papers · 3 claims

Elastin · Derived · Nitric · Oxide · Peptides

gzk@xxmu.edu.cn

Claims from this researcher:

Kanta, Jiří

1 papers · 3 claims

Elastin · Proliferation · Cells · Vgvapg · Pentapeptide

kanta@lfhk.cuni.cz

Claims from this researcher:

Donet, M

1 papers · 3 claims

Elastin · Secretion · Cells · Classifying · Synthetic

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Brassart-Pasco, S

1 papers · 3 claims

Elastin · Secretion · Cells · Classifying · Synthetic

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Salesse, S

1 papers · 3 claims

Elastin · Secretion · Cells · Classifying · Synthetic

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Maquart, F-X

1 papers · 3 claims

Elastin · Secretion · Cells · Classifying · Synthetic

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Brassart, B

1 papers · 3 claims

Elastin · Secretion · Cells · Classifying · Synthetic

bertrand.brassart@univ-reims.fr

Claims from this researcher:

McNally, Ross

1 papers · 3 claims

Derived · Elastin · Vgvapg · Extravillous · Trophoblast

l.mcclements@qub.ac.uk

Claims from this researcher:

Alqudah, Abdelrahim

🔗 ORCID

1 papers · 3 claims

Derived · Elastin · Vgvapg · Extravillous · Trophoblast

l.mcclements@qub.ac.uk

Claims from this researcher:

Obradovic, Danilo

1 papers · 3 claims

Derived · Elastin · Vgvapg · Extravillous · Trophoblast

l.mcclements@qub.ac.uk

Claims from this researcher:

McClements, Lana

1 papers · 3 claims

Derived · Elastin · Vgvapg · Extravillous · Trophoblast

l.mcclements@qub.ac.uk

Claims from this researcher:

Miller-Kobisher B, Suárez-Vega DV, Velazco de Maldonado GJ.

1 papers · 3 claims

Skin · Hyaluronic · Acid · Recombinant · Collagen

dubraskasuarez.ula@gmail.com

Claims from this researcher:

Gaitanis K, Gkogkou E, Laskaris P, Tsafantakis N, Gianniou DD, Kaili SI, Ntroumpogianni GC, Theodosopoulou A, Milic N, Hatzinikolaou DG, Fokialakis N, Trougakos IP, Karagouni AD.

1 papers · 3 claims

Cyclo · Elastase · Fibroblasts · Isolated · Cyclic

akar@biol.uoa.gr

Claims from this researcher:

Dewi DAR, Arimuko A, Norawati L, Yenny SW, Setiasih NL, Perdiyana A, Arkania N, Nadhira F, Wiliantari N.

1 papers · 3 claims

Skin · Collagen · Oral · Intake · Containing

dianandrianiratnadewi@gmail.com

Claims from this researcher:

Budatha M, Roshanravan S, Zheng Q, Weislander C, Chapman SL, Davis EC, Starcher B, Word RA, Yanagisawa H.

1 papers · 3 claims

Sequence · Inhibited · Fibronectin · Induced · Upregulation

Claims from this researcher:

Guo, Gao

1 papers · 3 claims

Containing · Chemotactic · Fibrillin · Egfepg · Peptide

Claims from this researcher:

Ramaswamy, Aneesh K.

1 papers · 3 claims

Elastin · Improved · Engineered · Protein · Overexpression

juw51@pitt.edu

Claims from this researcher:

Vorp, David A.

🔗 ORCID

1 papers · 3 claims

Elastin · Improved · Engineered · Protein · Overexpression

juw51@pitt.edu

Claims from this researcher:

Weinbaum, Justin S.

1 papers · 3 claims

Elastin · Improved · Engineered · Protein · Overexpression

juw51@pitt.edu

Claims from this researcher:

Hu S, Huo L, He J, Jin Y, Deng Y, Liu D.

1 papers · 3 claims

Ginseng · Glycoprotein · Treatment · Fiber · Structure

jy_ccucm@163.com

Claims from this researcher:

Boraldi, Federica

🔗 ORCID

1 papers · 3 claims

Elastin · Like · Peptide · Vggvg · Rate

daniela.quaglino@unimore.it

Claims from this researcher:

Moscarelli, Pasquale

1 papers · 3 claims

Elastin · Like · Peptide · Vggvg · Rate

daniela.quaglino@unimore.it

Claims from this researcher:

Salvi, Anna M.

🔗 ORCID

1 papers · 3 claims

Elastin · Like · Peptide · Vggvg · Rate

daniela.quaglino@unimore.it

Claims from this researcher:

Quaglino, Daniela

🔗 ORCID

1 papers · 3 claims

Elastin · Like · Peptide · Vggvg · Rate

daniela.quaglino@unimore.it

Claims from this researcher:

Smithmyer, Megan E.

1 papers · 3 claims

Glycine · Derived · Cultured · Sequence · Collagen

akloxin@udel.edu

Claims from this researcher:

Sawicki, Lisa A.

1 papers · 3 claims

Glycine · Derived · Cultured · Sequence · Collagen

akloxin@udel.edu

Claims from this researcher:

Kloxin, April M.

1 papers · 3 claims

Glycine · Derived · Cultured · Sequence · Collagen

akloxin@udel.edu

Claims from this researcher:

Kawecki C, Bocquet O, Schmelzer CEH, Heinz A, Ihling C, Wahart A, Romier B, Bennasroune A, Blaise S, Terryn C, Linton KJ, Martiny L, Duca L, Maurice P.

1 papers · 3 claims

Elastin · Peptide · Vvgspsaqdeaspl · Derived · Peptides

Claims from this researcher:

McQuitty, Claire E.

1 papers · 3 claims

Elastin · Derived · Peptides · Edps · Generated

luca.urbani@researchinliver.org.uk

Claims from this researcher:

Williams, Roger

1 papers · 3 claims

Elastin · Derived · Peptides · Edps · Generated

luca.urbani@researchinliver.org.uk

Claims from this researcher:

Chokshi, Shilpa

1 papers · 3 claims

Elastin · Derived · Peptides · Edps · Generated

luca.urbani@researchinliver.org.uk

Claims from this researcher:

Urbani, Luca

1 papers · 3 claims

Elastin · Derived · Peptides · Edps · Generated

luca.urbani@researchinliver.org.uk

Claims from this researcher:

Dal Col V, Marchi C, Ribas F, Franzen Matte B, Medeiros H, Domenici de Oliveira B, Viana R.

1 papers · 3 claims

Elastin · Bioactive · Peptides · Caha · Increase

leidalcol@gmail.com

Claims from this researcher:

Rivera-Sanchez SP, Ocampo-Ibáñez ID, Moncaleano MC, Liscano Y, Elvira LJF, Aristizabal Salazar YA, Martínez-Martínez L, Oñate-Garzon J.

1 papers · 3 claims

Peptide · Long · Residues · Short · Achieved

ivan.ocampo00@usc.edu.co

Claims from this researcher:

Rinaldi F, Pinto D, Trink A, Giuliani G, Sparavigna A.

1 papers · 3 claims

Collagen · Mixture · Alpha · Dipeptides · Tested

fabio.rinaldi@studiorinaldi.com

Claims from this researcher:

Cozlin-Martel, A.

1 papers · 3 claims

Elastin · Kappa · Peptides · Synthesis · Human

Claims from this researcher:

Barthelemi, S.

1 papers · 3 claims

Elastin · Kappa · Peptides · Synthesis · Human

Claims from this researcher:

Garnotel, Roselyne

1 papers · 3 claims

Elastin · Kappa · Peptides · Synthesis · Human

Claims from this researcher:

Decarme, Martine

1 papers · 3 claims

Elastin · Kappa · Peptides · Synthesis · Human

Claims from this researcher:

Guillaume, C.

1 papers · 3 claims

Elastin · Kappa · Peptides · Synthesis · Human

Claims from this researcher:

Kaplan, H.

1 papers · 3 claims

Elastin · Kappa · Peptides · Synthesis · Human

Claims from this researcher:

Laurent‐Maquin, D.

1 papers · 3 claims

Elastin · Kappa · Peptides · Synthesis · Human

Claims from this researcher:

Lorimier, Sandrine

1 papers · 3 claims

Elastin · Kappa · Peptides · Synthesis · Human

Claims from this researcher:

Han Y, Lin Y, Guo M, Wang Y, Dong X, Xiong L, Li L, Wang H, Hu X, Yang F.

1 papers · 3 claims

Binding · Ages · Molecular · Docking · Simulations

huxuefeng@scu.edu.cn

Claims from this researcher:

Dymek, Michał

1 papers · 3 claims

Copper · Tripeptide · Inhibition · Elastase · Sequence

michal.dymek@doktorant.pk.edu.pl

Claims from this researcher:

Olechowska, Karolina

1 papers · 3 claims

Copper · Tripeptide · Inhibition · Elastase · Sequence

michal.dymek@doktorant.pk.edu.pl

Claims from this researcher:

Hąc-Wydro, Katarzyna

1 papers · 3 claims

Copper · Tripeptide · Inhibition · Elastase · Sequence

michal.dymek@doktorant.pk.edu.pl

Claims from this researcher:

Sikora, Elżbieta

1 papers · 3 claims

Copper · Tripeptide · Inhibition · Elastase · Sequence

michal.dymek@doktorant.pk.edu.pl

Claims from this researcher:

Sato, Fumiaki

1 papers · 3 claims

Nhdf · Cells · Tropoelastin · Assembly · Tagged

Claims from this researcher:

Seino-Sudo, Ryo

1 papers · 3 claims

Nhdf · Cells · Tropoelastin · Assembly · Tagged

Claims from this researcher:

Okada, Mami

1 papers · 3 claims

Nhdf · Cells · Tropoelastin · Assembly · Tagged

Claims from this researcher:

Sakai, Hiroyasu

1 papers · 3 claims

Nhdf · Cells · Tropoelastin · Assembly · Tagged

Claims from this researcher:

Yumoto, Tetsuro

1 papers · 3 claims

Nhdf · Cells · Tropoelastin · Assembly · Tagged

Claims from this researcher:

Poulis N, Martin M, Hoerstrup SP, Emmert MY, Fioretta ES.

1 papers · 3 claims

Peptide · Elastin · Derived · Cells · Vgvapg

maximilian.emmert@irem.uzh.ch

Claims from this researcher:

Akthar, Samia

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Patel, Dhiren F.

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Beale, Rebecca C.

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Peiró, Teresa

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Xu, Xin

🔗 ORCID

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Gaggar, Amit

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Jackson, Patricia L.

🔗 ORCID

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Blalock, J. Edwin

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Lloyd, Clare M.

🔗 ORCID

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Snelgrove, Robert J.

1 papers · 3 claims

Proline · Glycine · Wild · Type · Mice

robert.snelgrove@imperial.ac.uk

Claims from this researcher:

Jones, Nicole

1 papers · 3 claims

Peptide · Lung · Fibrosis · Uptake · Fibrogenesis

nmjones7@wisc.edu

Claims from this researcher:

Rahar, Babita

1 papers · 3 claims

Peptide · Lung · Fibrosis · Uptake · Fibrogenesis

nmjones7@wisc.edu

Claims from this researcher:

Bernau, Ksenija

1 papers · 3 claims

Peptide · Lung · Fibrosis · Uptake · Fibrogenesis

nmjones7@wisc.edu

Claims from this researcher:

Schulte, Jefree J.

1 papers · 3 claims

Peptide · Lung · Fibrosis · Uptake · Fibrogenesis

nmjones7@wisc.edu

Claims from this researcher:

Campagnola, Paul J.

🔗 ORCID

1 papers · 3 claims

Peptide · Lung · Fibrosis · Uptake · Fibrogenesis

nmjones7@wisc.edu

Claims from this researcher:

Brasier, Allan R.

1 papers · 3 claims

Peptide · Lung · Fibrosis · Uptake · Fibrogenesis

nmjones7@wisc.edu

Claims from this researcher:

Babini E, Taneyo-Saa DL, Tassoni A, Ferri M, Kraft A, Grän-Heedfeld J, Bretz K, Roda A, Michelini E, Calabretta MM, Guillon F, Tagliazucchi D, Martini S, Nissen L, Gianotti A.

1 papers · 3 claims

Peptide · Fraction · Derived · Fermentation · Elastin

elena.babini2@unibo.it

Claims from this researcher:

Wozny, Michael R.

1 papers · 3 claims

Full · Length · Protein · Sequence · Binds

mike.strauss@mcgill.ca

Claims from this researcher:

Nelea, Valentin

1 papers · 3 claims

Full · Length · Protein · Sequence · Binds

mike.strauss@mcgill.ca

Claims from this researcher:

Siddiqui, Iram

1 papers · 3 claims

Full · Length · Protein · Sequence · Binds

mike.strauss@mcgill.ca

Claims from this researcher:

Wanga, Shaynah

1 papers · 3 claims

Full · Length · Protein · Sequence · Binds

mike.strauss@mcgill.ca

Claims from this researcher:

Waard, Vivian de

1 papers · 3 claims

Full · Length · Protein · Sequence · Binds

mike.strauss@mcgill.ca

Claims from this researcher:

Strauss, Mike

1 papers · 3 claims

Full · Length · Protein · Sequence · Binds

mike.strauss@mcgill.ca

Claims from this researcher:

Reinhardt, Dieter P.

1 papers · 3 claims

Full · Length · Protein · Sequence · Binds

mike.strauss@mcgill.ca

Claims from this researcher:

Rosiak, Piotr

1 papers · 3 claims

Elastin · Peptide · Alginate · Activity · When

piotr.rosiak@dokt.p.lodz.pl

Claims from this researcher:

Latanska, Ilona

1 papers · 3 claims

Elastin · Peptide · Alginate · Activity · When

piotr.rosiak@dokt.p.lodz.pl

Claims from this researcher:

Paul, Paulina

1 papers · 3 claims

Elastin · Peptide · Alginate · Activity · When

piotr.rosiak@dokt.p.lodz.pl

Claims from this researcher:

Sujka, Witold

1 papers · 3 claims

Elastin · Peptide · Alginate · Activity · When

piotr.rosiak@dokt.p.lodz.pl

Claims from this researcher:

Kolesinska, Beata

1 papers · 3 claims

Elastin · Peptide · Alginate · Activity · When

piotr.rosiak@dokt.p.lodz.pl

Claims from this researcher:

Steinberg, Thorsten

🔗 ORCID

1 papers · 3 claims

Gingival · Peptide · Mimetic · Meta · Phenylene

martin.dieterle@uniklinik-freiburg.de

Claims from this researcher:

Dieterle, Martin Philipp

1 papers · 3 claims

Gingival · Peptide · Mimetic · Meta · Phenylene

martin.dieterle@uniklinik-freiburg.de

Claims from this researcher:

Tomakidi, Pascal

1 papers · 3 claims

Gingival · Peptide · Mimetic · Meta · Phenylene

martin.dieterle@uniklinik-freiburg.de

Claims from this researcher:

Yue T, Xiong S, Zheng D, Wang Y, Long P, Yang J, Danzeng D, Gao H, Wen X, Li X, Hou J.

1 papers · 3 claims

Peptide · Self · Elastin · Mimetic · Hydrogel

wenxd131@163.com

Claims from this researcher:

Jo, Yun Kee

1 papers · 3 claims

Peptide · Hydrogels · Organoids · Like · Chemically

ykjo@knu.ac.kr

Claims from this researcher:

Baumann, Leslie

1 papers · 3 claims

Lysine · Collagen · Threonine · Tripeptide · Copper

lgrunebaum@med.miami.edu

Claims from this researcher:

Grunebaum, Lisa D.

1 papers · 3 claims

Lysine · Collagen · Threonine · Tripeptide · Copper

lgrunebaum@med.miami.edu

Claims from this researcher:

Tafuri A, Panunzio A, Tricarico M, Tricarico EM, Mazzarella CR.

1 papers · 3 claims

Group · Oral · Weight · Specific · Bioactive

panunzioandrea@virgilio.it

Claims from this researcher:

Pintea, Andrada

1 papers · 3 claims

Palmitoyl · Collagen · Application · Containing · Signal

adriana.ciurba@umfst.ro

Claims from this researcher:

Manea, Andrei

1 papers · 3 claims

Palmitoyl · Collagen · Application · Containing · Signal

adriana.ciurba@umfst.ro

Claims from this researcher:

Pintea, Cezara

1 papers · 3 claims

Palmitoyl · Collagen · Application · Containing · Signal

adriana.ciurba@umfst.ro

Claims from this researcher:

Vlad, Robert-Alexandru

1 papers · 3 claims

Palmitoyl · Collagen · Application · Containing · Signal

adriana.ciurba@umfst.ro

Claims from this researcher:

Bîrsan, Magdalena

1 papers · 3 claims

Palmitoyl · Collagen · Application · Containing · Signal

adriana.ciurba@umfst.ro

Claims from this researcher:

Antonoaea, Paula

1 papers · 3 claims

Palmitoyl · Collagen · Application · Containing · Signal

adriana.ciurba@umfst.ro

Claims from this researcher:

Rédai, Emöke Margit

1 papers · 3 claims

Palmitoyl · Collagen · Application · Containing · Signal

adriana.ciurba@umfst.ro

Claims from this researcher:

Ciurba, Adriana

1 papers · 3 claims

Palmitoyl · Collagen · Application · Containing · Signal

adriana.ciurba@umfst.ro

Claims from this researcher:

Bourguet, Erika

1 papers · 3 claims

Acid · Oleoyl · Galardin · Compound · Against

Claims from this researcher:

Sápi, János

1 papers · 3 claims

Acid · Oleoyl · Galardin · Compound · Against

Claims from this researcher:

Jean-Paul, Alain

1 papers · 3 claims

Acid · Oleoyl · Galardin · Compound · Against

Claims from this researcher:

Moroy, Gautier

1 papers · 3 claims

Acid · Oleoyl · Galardin · Compound · Against

Claims from this researcher:

Siahaan, Evi Amelia

1 papers · 3 claims

Activity · Hydrolysate · Scavenging · Fraction · Hydrolyzed

sknkim@pknu.ac.kr

Claims from this researcher:

Agusman

1 papers · 3 claims

Activity · Hydrolysate · Scavenging · Fraction · Hydrolyzed

sknkim@pknu.ac.kr

Claims from this researcher:

Pangestuti, Ratih

1 papers · 3 claims

Activity · Hydrolysate · Scavenging · Fraction · Hydrolyzed

sknkim@pknu.ac.kr

Claims from this researcher:

Shin, Kyung-Hoon

1 papers · 3 claims

Activity · Hydrolysate · Scavenging · Fraction · Hydrolyzed

sknkim@pknu.ac.kr

Claims from this researcher:

Kim, Se-Kwon

1 papers · 3 claims

Activity · Hydrolysate · Scavenging · Fraction · Hydrolyzed

sknkim@pknu.ac.kr

Claims from this researcher:

Bonnet, Dominique

🔗 ORCID

1 papers · 3 claims

Vpglg · Variable · Elastin · Like · Exhibited

m@5z.com

Claims from this researcher:

Guo, Yifan

🔗 ORCID

1 papers · 3 claims

Collagen · Activity · Glycyl · Histidyl · Lysine

hexin22@mails.tsinghua.edu.cn

Claims from this researcher:

He, Bingwei

1 papers · 3 claims

Chimeric · Peptide · Elastase · Activity · Terminal

quliping@winona.cn

Claims from this researcher:

Wang, Feifei

🔗 ORCID

1 papers · 3 claims

Chimeric · Peptide · Elastase · Activity · Terminal

quliping@winona.cn

Claims from this researcher:

Qu, Liping

1 papers · 3 claims

Chimeric · Peptide · Elastase · Activity · Terminal

quliping@winona.cn

Claims from this researcher:

Serrano-Sandoval SN, Jiménez-Rodríguez A, Hernández-Pérez J, Chavez-Santoscoy RA, Guardado-Félix D, Antunes-Ricardo M.

1 papers · 3 claims

Selenized · Elastase · Metsecys · Standard · Concentration

daniela.guardado@uas.edu.mx

Claims from this researcher:

Lameiras, Pedro

1 papers · 3 claims

Agvpglgvg · Tumor · Fold · Compared · Higher

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Beljebbar, Abdelilah

1 papers · 3 claims

Agvpglgvg · Tumor · Fold · Compared · Higher

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Berquand, Alexandre

1 papers · 3 claims

Agvpglgvg · Tumor · Fold · Compared · Higher

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Villemin, Matthieu

1 papers · 3 claims

Agvpglgvg · Tumor · Fold · Compared · Higher

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Dukic, Sylvain

1 papers · 3 claims

Agvpglgvg · Tumor · Fold · Compared · Higher

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Nuzillard, Jean-Marc

1 papers · 3 claims

Agvpglgvg · Tumor · Fold · Compared · Higher

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Molinari, Michael

1 papers · 3 claims

Agvpglgvg · Tumor · Fold · Compared · Higher

bertrand.brassart@univ-reims.fr

Claims from this researcher:

Chen M, Sun Y, Zhu L, Li L, Zhao Y.

1 papers · 3 claims

Rrfa · Elastin · Mrna · Human · Dermal

chenmo@jahwa.com.cn

Claims from this researcher:

Zhao H, Liu M, Chen L, Gong Y, Ma W, Jiang Y.

1 papers · 3 claims

Dose · Melittin · Collagen · Expression · Levels

zhaohuiting@sxau.edu.cn

Claims from this researcher:

Zhu H, Guo X, Zhang Y, Khan A, Pang Y, Song H, Zhao H, Liu Z, Qiao H, Xie J.

1 papers · 3 claims

Hydrolyzed · Collagen · Oligopeptides · Hcops · Skin

zhm18536062073@163.com

Claims from this researcher:

Kobiela, Tomasz

1 papers · 3 claims

Hacat · Acetyl · Tetrapeptide · Stiffness · Tested

kobiela@ch.pw.edu.pl

Claims from this researcher:

Milner-Krawczyk, Małgorzata

1 papers · 3 claims

Hacat · Acetyl · Tetrapeptide · Stiffness · Tested

kobiela@ch.pw.edu.pl

Claims from this researcher:

Pasikowska-Piwko, Monika

1 papers · 3 claims

Hacat · Acetyl · Tetrapeptide · Stiffness · Tested

kobiela@ch.pw.edu.pl

Claims from this researcher:

Bobecka-Wesołowska, Konstancja

1 papers · 3 claims

Hacat · Acetyl · Tetrapeptide · Stiffness · Tested

kobiela@ch.pw.edu.pl

Claims from this researcher:

Święszkowski, Wojciech

🔗 ORCID

1 papers · 3 claims

Hacat · Acetyl · Tetrapeptide · Stiffness · Tested

kobiela@ch.pw.edu.pl

Claims from this researcher:

Tałałaj, Urszula

1 papers · 3 claims

Collagen · Biosynthesis · Acetylated · Peptide · Activity

talalaj.urszula@gmail.com

Claims from this researcher:

Uścinowicz, Paulina

1 papers · 3 claims

Collagen · Biosynthesis · Acetylated · Peptide · Activity

talalaj.urszula@gmail.com

Claims from this researcher:

Bruzgo, Irena

1 papers · 3 claims

Collagen · Biosynthesis · Acetylated · Peptide · Activity

talalaj.urszula@gmail.com

Claims from this researcher:

Surażyński, Arkadiusz

🔗 ORCID

1 papers · 3 claims

Collagen · Biosynthesis · Acetylated · Peptide · Activity

talalaj.urszula@gmail.com

Claims from this researcher:

Zaręba, Ilona

1 papers · 3 claims

Collagen · Biosynthesis · Acetylated · Peptide · Activity

talalaj.urszula@gmail.com

Claims from this researcher:

Markowska, Agnieszka

1 papers · 3 claims

Collagen · Biosynthesis · Acetylated · Peptide · Activity

talalaj.urszula@gmail.com

Claims from this researcher:

Odoul, Ludivine

1 papers · 3 claims

Derived · Elastin · Peptides · Vgvapg · Type

laurent.duca@univ-reims.fr

Claims from this researcher:

Salesse, Stéphanie

1 papers · 3 claims

Derived · Elastin · Peptides · Vgvapg · Type

laurent.duca@univ-reims.fr

Claims from this researcher:

Guillot, Alexandre

1 papers · 3 claims

Derived · Elastin · Peptides · Vgvapg · Type

laurent.duca@univ-reims.fr

Claims from this researcher:

Kawecki, Charlotte

1 papers · 3 claims

Derived · Elastin · Peptides · Vgvapg · Type

laurent.duca@univ-reims.fr

Claims from this researcher:

O'Rourke SA, Dunne A, Monaghan MG.

1 papers · 3 claims

Derived · Elastin · Production · Matrix · Infiltration

monaghmi@tcd.ie

Claims from this researcher:

Seidl, Stephanie E.

1 papers · 3 claims

Elastin · Synthetic · Lipoprotein · Mrna · Expression

schreibe@bu.edu

Claims from this researcher:

Pessolano, Lawrence G.

1 papers · 3 claims

Elastin · Synthetic · Lipoprotein · Mrna · Expression

schreibe@bu.edu

Claims from this researcher:

Bishop, Christopher A.

1 papers · 3 claims

Elastin · Synthetic · Lipoprotein · Mrna · Expression

schreibe@bu.edu

Claims from this researcher:

Best, Michael

1 papers · 3 claims

Elastin · Synthetic · Lipoprotein · Mrna · Expression

schreibe@bu.edu

Claims from this researcher:

Rich, Celeste B.

1 papers · 3 claims

Elastin · Synthetic · Lipoprotein · Mrna · Expression

schreibe@bu.edu

Claims from this researcher:

Stone, Phillip J.

1 papers · 3 claims

Elastin · Synthetic · Lipoprotein · Mrna · Expression

schreibe@bu.edu

Claims from this researcher:

Schreiber, Barbara M.

1 papers · 3 claims

Elastin · Synthetic · Lipoprotein · Mrna · Expression

schreibe@bu.edu

Claims from this researcher:

Albrecht, Camille

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Kuznetsov, Andrey S.

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Appert-Collin, Aline

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Dhaideh, Zineb

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Callewaert, Maïté

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Bershatsky, Yaroslav V.

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Urban, Anatoly S.

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Bocharov, Eduard V.

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Bagnard, Dominique

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Efremov, Roman G.

🔗 ORCID

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

Gueroult, Marc

1 papers · 3 claims

Peptide · Activity · Intpep · Sialidase · Stimulated

marc.gueroult@univ-reims.fr

Claims from this researcher:

MA, Babizhayev

1 papers · 3 claims

Carnosine · Cultured · Fibroblasts · Telomere · Successfully

markbabizhayev@yahoo.com

Claims from this researcher:

Donet, Mélissa

1 papers · 3 claims

Synthetic · Elastin · Cells · Activity · Peptide

Claims from this researcher:

Seurat, Emeline

1 papers · 3 claims

Synthetic · Elastin · Cells · Activity · Peptide

Claims from this researcher:

Hague, Frédéric

1 papers · 3 claims

Synthetic · Elastin · Cells · Activity · Peptide

Claims from this researcher:

Velard, Fréderic

1 papers · 3 claims

Synthetic · Elastin · Cells · Activity · Peptide

Claims from this researcher:

Michel, Jean

1 papers · 3 claims

Synthetic · Elastin · Cells · Activity · Peptide

Claims from this researcher:

Monboisse, Jean-Claude

1 papers · 3 claims

Synthetic · Elastin · Cells · Activity · Peptide

Claims from this researcher:

Hinek, Aleksander

🔗 ORCID

1 papers · 3 claims

Synthetic · Elastin · Cells · Activity · Peptide

Claims from this researcher:

Maquart, François-Xavier

1 papers · 3 claims

Synthetic · Elastin · Cells · Activity · Peptide

Claims from this researcher:

Gomes A, Bessa LJ, Fernandes I, Ferraz R, Mateus N, Gameiro P, Teixeira C, Gomes P.

1 papers · 3 claims

Peptide · Sequence · Collagenesis · Reference · Inducing

pgomes@fc.up.pt

Claims from this researcher:

Rabenoelina, Fanja

1 papers · 3 claims

Elastin · Fibroblasts · Significantly · Young · Activity

laurent.duca@univ-reims.fr

Claims from this researcher:

Chaintreuil, Carine

1 papers · 3 claims

Elastin · Fibroblasts · Significantly · Young · Activity

laurent.duca@univ-reims.fr

Claims from this researcher:

Rusciani, Anthony

1 papers · 3 claims

Elastin · Fibroblasts · Significantly · Young · Activity

laurent.duca@univ-reims.fr

Claims from this researcher:

Wang, Mingyi

🔗 ORCID

1 papers · 3 claims

Elastin · Derived · Vgvapg · Hexapeptide · Mouse

raginskik@nia.nih.gov

Claims from this researcher:

McGraw, Kimberly R.

1 papers · 3 claims

Elastin · Derived · Vgvapg · Hexapeptide · Mouse

raginskik@nia.nih.gov

Claims from this researcher:

Monticone, Robert E.

1 papers · 3 claims

Elastin · Derived · Vgvapg · Hexapeptide · Mouse

raginskik@nia.nih.gov

Claims from this researcher:

Pintus, Gianfranco

1 papers · 3 claims

Elastin · Derived · Vgvapg · Hexapeptide · Mouse

raginskik@nia.nih.gov

Claims from this researcher:

Resende DISP, Ferreira MS, Sousa-Lobo JM, Sousa E, Almeida IF.

1 papers · 3 claims

Palmitoyl · Valyl · Collagen · Type · Hexapeptide

dresende@ff.up.pt

Claims from this researcher:

Tieché, Christopher

1 papers · 3 claims

Elastin · Peptide · Vgvapg · Upregulates · Timp

Claims from this researcher:

Raffetto, Joseph D.

1 papers · 3 claims

Peptide · Achieved · Compression · Weeks · Competitive

raouf_khalil@hms.harvard.edu

Claims from this researcher:

Ligi, Daniela

1 papers · 3 claims

Peptide · Achieved · Compression · Weeks · Competitive

raouf_khalil@hms.harvard.edu

Claims from this researcher:

Maniscalco, Rosanna

1 papers · 3 claims

Peptide · Achieved · Compression · Weeks · Competitive

raouf_khalil@hms.harvard.edu

Claims from this researcher:

Khalil, Raouf A.

1 papers · 3 claims

Peptide · Achieved · Compression · Weeks · Competitive

raouf_khalil@hms.harvard.edu

Claims from this researcher:

Mannello, Ferdinando

🔗 ORCID

1 papers · 3 claims

Peptide · Achieved · Compression · Weeks · Competitive

raouf_khalil@hms.harvard.edu

Claims from this researcher:

Bang, Jinho

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Hwang, Yul-Lye

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Kim, Mi Yoon

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Yun, Jae Nam

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Hyun, Eujin

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Chang, Min Youl

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Shin, Dae Hwan

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Kim, Sunghyun

🔗 ORCID

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Lee, Jeung-Hoon

1 papers · 3 claims

Peptide · Rrgvrr · Affinity · Nachr · Response

bjh619@skinmed.biz

Claims from this researcher:

Yang, Lirong

🔗 ORCID

1 papers · 3 claims

Fibrin · Gels · Engineered · Fusion · Protein

Claims from this researcher:

Aubdool, Aisah A

1 papers · 3 claims